KEGG   Canis familiaris (dog): 483011
Entry
483011            CDS       T01007                                 

Gene name
SNX17
Definition
(RefSeq) sorting nexin-17
  KO
K17929  sorting nexin-17
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    483011 (SNX17)
SSDB
Motif
Pfam: SNX17_FERM_C PX RA Ras_bdg_2 Nod1 FERM_M DUF2777
Other DBs
NCBI-GeneID: 483011
NCBI-ProteinID: XP_540126
Ensembl: ENSCAFG00000004899
VGNC: 46626
UniProt: A0A5F4BY76
Position
17
AA seq 470 aa
MHFSIPETESRSGDSGGSAYVAYNIHVNGVLHCRVRYSQLLGLHEQLRKEYGANVLPAFP
PKKLFSLTPAEVEQRREQLEKYMQAVRQDPLLGSSETFNSFLRRAQQETQQVPTEEVSLE
VLLSNGQKVLVNVLTSDQTEDVLEAVAAKLDLPDDLIGYFSLFLVREKEDGTFSFVRKLQ
EFELPYVSVTSLRSQEYKIVLRKSYWDSAYDDDVMENRVGLNLLYAQTVSDIERGWILVT
KEQHRQLKSLQEKVSKKEFLRLAQTLRHYGYLRFDACVADFPEKDCPVVVSAGNSELSLQ
LRLPGQQLREGSFRVTRMRCWRVTSSVPLPSGSTSSPGRGRGEVRLELAFEYLMSKDRLQ
WVTITSPQAIMMSICLQSMVDELMVKKSGGSIRKMLRRRVGGTLRRSDSQQAVKSPPLLE
SPDASRESMVKLSSKLSAVSLRGIGSPSTDASASDVHGNFAFEGIGDEDL
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgcacttttccattcctgaaaccgagtcccgcagcggggacagcggcggctccgcctat
gtggcctacaacattcacgtgaatggagtcctgcattgccgggtgcgctacagccagctc
ctggggctgcacgagcagcttcggaaggagtatggggccaatgtccttcctgcatttccc
ccaaagaagcttttctctctgacacctgctgaggtggaacagcggagagagcagttagaa
aagtacatgcaagctgttcggcaggacccactgcttgggagcagtgagacctttaatagc
ttcctgcgtcgggcacaacaggagacacagcaggtccccacagaggaggtttccttggaa
gtgctgctcagcaacgggcagaaagttctggtcaatgtgctaacttcagatcagactgaa
gatgtcctagaggctgtggctgcaaaactggatcttccagatgacttgattggatacttt
agtctctttctagttcgagagaaagaggatggaaccttttctttcgtacggaagttgcaa
gagtttgagctgccttatgtgtctgttaccagccttcggagtcaagagtataagattgtg
ctaaggaagagttattgggattctgcctatgatgacgatgtcatggagaaccgggttggc
ctgaacctgctatatgctcagacagtatcagacattgagcgtgggtggattctggtcacc
aaggagcaacaccggcagctcaaatctctgcaagagaaggtctccaagaaggagttccta
cgactggctcagaccctgcggcactatggctacttgcgctttgatgcctgtgtggctgac
ttcccagagaaggactgtcccgtggtggtgagcgcaggcaacagtgagctcagcctccag
ctccgcttgcctggccagcaactccgtgaaggctccttccgggtcacccgcatgcggtgc
tggcgggtcacctcctctgtgccactgcccagtggaagcacaagtagcccaggccggggc
cggggtgaggtgcgcctggaactggcttttgaatacctcatgagcaaggaccggctacag
tgggtcaccatcaccagcccccaggctatcatgatgagtatctgcttgcagtccatggta
gatgaactgatggtgaagaaatctggtggcagcatcaggaagatgctgcgccggcgagtg
gggggcaccctgagacgctcagacagccagcaagcagtgaagtccccgcccctgcttgag
tcacctgatgccagccgggagtccatggttaaactctcaagcaagctgagtgccgtgagc
ttgcgggggattggcagtcccagcacagatgccagtgccagtgatgtccacggcaatttt
gccttcgagggcattggagatgaggatctgtga

DBGET integrated database retrieval system