KEGG   Canis lupus familiaris (dog): 483031
Entry
483031            CDS       T01007                                 

Gene name
FEZ2
Definition
(RefSeq) fasciculation and elongation protein zeta-2 isoform X2
Organism
cfa  Canis lupus familiaris (dog)
SSDB
Motif
Pfam: FEZ Gluconate_2-dh3 MRP-L46
Other DBs
NCBI-GeneID: 483031
NCBI-ProteinID: XP_005630388
Ensembl: ENSCAFG00000005904
VGNC: 40828
UniProt: A0A5F4BW80
Position
17
AA seq 376 aa
MAADGDWQDFYEFQEPARSLQDQENCNASPEAGAGPGGGGDGFPALACSLEEKLSLCFRP
SGPGAEPPRAAVRPITECSLLQGDEIWNALTDNYGNVMPVDWKSSHTRTLHLLTLNLSEK
GISDSLLFDTSDDEELREQLDMHSIIVSCVNEEPLFTADQVIEEIEEMMQESPDPEDDET
PTQSDRLSMLSQEIQTLQRSSTSSYEERVKRLSVCELNELLEEIESAIKEYSEELVQQLA
LRDELEFEKEVKNSFISVLIEVQNKQKEHKETAKKKKKLKNGSSQNGKNERSHMPGTRFS
MEGISNVIQNGLRHTFGNSGGEKQYLTTVIPYEKKNGPPSVEDLQILTKILRAMKEDSEK
VPSLLTDYILKVLCPT
NT seq 1131 nt   +upstreamnt  +downstreamnt
atggcggcggacggggactggcaggatttctatgagttccaggagccagcccggagcctc
caggaccaggagaactgtaacgcgagccccgaggccggcgcagggccgggcgggggaggc
gacggcttcccggcgctggcctgcagcttggaggagaagctgagcctgtgtttccgcccc
tcgggtccgggcgccgagcccccgagggcggcagtgcggcccatcaccgagtgcagcctc
ctgcagggggacgagatttggaacgccctgacagataattatggaaacgtaatgcctgta
gactggaagtcatctcacaccagaaccttgcatttgcttacactgaacctctcagaaaaa
gggataagtgacagtttgctctttgatacatcagacgatgaggagctgagagaacagctg
gatatgcattcaatcatcgtctcctgcgttaatgaagagcccctcttcactgcagatcag
gttattgaagaaattgaagaaatgatgcaggaatctccagacccagaagatgatgaaacg
ccaacccagtcagatcggctgtcaatgctgtcccaggaaatccagactcttcagaggtcc
agcacaagcagttacgaagagagagtcaaaaggctctctgtatgtgaattaaatgaactc
ctggaagaaattgagagtgccatcaaggagtattctgaagagctggtgcagcagttggcc
ctgcgagatgagctggagtttgaaaaggaagtgaaaaacagctttatttctgttctcatt
gaagtacaaaacaaacagaaagagcacaaagaaacagccaagaagaaaaagaaactcaag
aatggcagctctcagaatgggaagaatgagagaagtcatatgcccggcacacgcttcagc
atggaagggatctcaaatgtcattcagaatggcctccgccacacctttggaaattcaggt
ggagagaaacagtacttgacaacagtcattccctatgagaaaaaaaatggaccaccatct
gttgaagatcttcaaatattaacaaaaattcttcgtgccatgaaagaggacagtgaaaag
gttccaagcttgttaactgattatatactgaaagtgctctgtcctacatag

DBGET integrated database retrieval system