KEGG   Canis lupus familiaris (dog): 483172
Entry
483172            CDS       T01007                                 
Symbol
H3C13
Name
(RefSeq) histone H3 isoform X4
  KO
K11253  histone H3
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04613  Neutrophil extracellular trap formation
cfa05034  Alcoholism
cfa05202  Transcriptional misregulation in cancer
cfa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    483172 (H3C13)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    483172 (H3C13)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    483172 (H3C13)
  09165 Substance dependence
   05034 Alcoholism
    483172 (H3C13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cfa03036]
    483172 (H3C13)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfa04147]
    483172 (H3C13)
Chromosome and associated proteins [BR:cfa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    483172 (H3C13)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   483172 (H3C13)
SSDB
Motif
Pfam: Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 483172
NCBI-ProteinID: XP_013976105
Ensembl: ENSCAFG00000041871
VGNC: 83706
Position
17:complement(58556954..58577480)
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggctcgtacgaaacagaccgcccgcaagtcgaccggcggcaaggccccgcgcaagcag
ctggccaccaaggcggcccgcaagagcgcgccggccacgggcggcgtcaagaagccgcac
cgctaccggccgggcacggtggccctgcgcgagatccggcgctaccagaagtccacggag
ctgctgatccgcaagctgccgttccagcggctggtgcgcgagatcgcgcaggacttcaag
acggacctgcgcttccagagctcggccgtcatggcgctgcaggaggcgagcgaggcctac
ctggtggggctcttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc
atgcccaaggacatccagctggcgcgccgcatccgcggggagcgcgcctag

DBGET integrated database retrieval system