KEGG   Canis familiaris (dog): 483745Help
Entry
483745            CDS       T01007                                 

Gene name
CAPN1
Definition
(RefSeq) calpain-1 catalytic subunit
  KO
K01367  calpain-1 [EC:3.4.22.52]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04141  Protein processing in endoplasmic reticulum
cfa04210  Apoptosis
cfa04217  Necroptosis
cfa04218  Cellular senescence
cfa05010  Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    483745 (CAPN1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    483745 (CAPN1)
   04217 Necroptosis
    483745 (CAPN1)
   04218 Cellular senescence
    483745 (CAPN1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    483745 (CAPN1)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.52  calpain-1
     483745 (CAPN1)
Peptidases [BR:cfa01002]
 Cysteine Peptidases
  Family C2: calpain family
   483745 (CAPN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C2 Calpain_III EF-hand_8 EF-hand_6 EF-hand_1 EF-hand_7
Motif
Other DBs
NCBI-GeneID: 483745
NCBI-ProteinID: XP_540866
Ensembl: ENSCAFG00000013830
VGNC: 38698
Position
18
AA seq 712 aa AA seqDB search
MAEEIITPVYCTGVSAQVQKQRAKELGLGRHENAIKYMGQDFEQLRAHCLQSGALFRDEA
FPPVPQSLGYKDLGPNSSKTYGIKWKRPTELLSNPQFIVDGATRTDICQGALGDCWLLAA
IASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHS
AQGNEFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDLYQIILK
ALERGSLLGCSIDISSVLDMEAITFKKLVKGHAYSVTGAKQVNYQGQMVSLIRMRNPWGE
VEWTGAWSDGGNNVDPSEREQLRVKMEDGEFWMSFRDFMREFTRLEICNLTPDALKSRSI
RKWNTTLYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLEETDDVDDDYGGRESGCSFVLA
LMQKHRRRERRFGRDMETIGFAVYEVPPELVGQPAVHLKRDFFLANSSRARSEQFINLRE
VSTRFRLPPGEYVVVPSTFEPNKEGDFVLRFFSEKSAGTEELDDQIQANLPDEQVLSEEE
IDENFKALFRQLAGEDMEISVKELQTILNRIISKHKDLRTKGFSLESCRSMVNLMDRDGN
GKLGLVEFNILWNRIRNYLSIFRKFDLDKSGSMSAYEMRMAIESAGFKLNKKLYELIITR
YSEPDLAVDFDNFVCCLVRLETMFRFFKTLDTDLDGVVTFDLFKWLQLTMFA
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggagatcatcaccccagtgtactgcactggggtgtctgcacaagtgcagaag
cagcgggccaaggagctgggccttggccgccatgagaacgccatcaagtacatgggccag
gactttgagcagctgcgagcacactgcctgcagagtggggccctcttccgtgatgaggcc
ttccccccggtaccccagagcctaggctacaaggacctgggccctaactcctccaaaacc
tatggcatcaagtggaagcgtcccacggagctgctctcaaacccccagttcattgtggat
ggagccacccgcacagacatctgccagggagcactgggggactgttggcttctggctgcc
attgcctccctcaccctcaatgacacgcttctgcatcgagtggttccacacggccaaagc
ttccagaatggctatgctggcatcttccatttccagctgtggcagtttggggaatgggtg
gatgtggtcgtggatgacctgctgcccatcaaggacgggaagctggtgtttgtgcactcc
gcccaaggcaacgagttctggagtgccctgcttgagaaggcctatgccaaggtgaatggc
agctacgaggccctctctgggggcagcacctcagagggctttgaggacttcacaggtggg
gtgacagaatggtatgagctgcgcaaggcacccagcgacctctaccaaatcatcctcaag
gccctggagcgaggttctctcctgggctgctccattgacatctccagcgttctagacatg
gaggccatcactttcaagaagctggtgaagggccatgcctactctgtgacaggggccaag
caggtgaactaccagggccagatggtgagcctgatccggatgcggaatccttggggcgag
gtggagtggacgggagcctggagtgacggagggaacaacgtggaccctagcgaaagggag
cagctccgggtcaagatggaggatggagagttctggatgtccttccgagacttcatgcgt
gagttcacccggttggagatctgcaacctgacacccgatgcgctcaagagccggtccatc
cgtaaatggaacaccacactctacgagggcacctggcggcgggggagcaccgcggggggc
tgccggaactacccagccaccttctgggtcaatccccagttcaagatccggctggaggag
acagatgatgtggacgacgactacgggggtcgcgaatcaggctgcagcttcgtgctagcc
ctcatgcagaagcaccgccgccgcgaacgccgctttggccgcgacatggagaccattggc
ttcgcggtctacgaggtccctccggagctggtgggccagcccgccgtgcacctgaagcgc
gacttcttcctggctaattcgtcccgggcacgttcggagcagttcatcaacctgcgggag
gtcagcacccgcttccgcttgccacccggggagtacgtggtggtcccctccacctttgag
cccaacaaggagggtgactttgtgctgcgcttcttctcggagaagagcgccgggacggag
gagctggacgaccagatccaggccaatctccctgatgagcaagtgctctcagaagaagag
attgatgagaacttcaaggccctcttcaggcaactggcaggggaggacatggagatcagc
gtcaaggagctgcagaccatcctcaacaggatcatcagcaagcacaaggacctacgtacc
aagggcttcagcctggagtcatgccgcagcatggtgaacctcatggacagggatggcaat
gggaagctgggcctggtggagttcaacatcctgtggaaccgcatccggaattacctgtcc
atcttccggaagtttgacttggacaagtcgggcagcatgagtgcctacgagatgcggatg
gccattgagtctgcaggcttcaagctcaacaagaagctgtatgagctcattatcacccgc
tactcggagccagacctggccgtggactttgacaactttgtgtgctgcctagtacgcctg
gagaccatgttccggtttttcaaaactctggacacagatctggatggagtggtgactttt
gatttgtttaagtggttacagctgaccatgtttgcatga

DBGET integrated database retrieval system