KEGG   Canis lupus familiaris (dog): 483758
Entry
483758            CDS       T01007                                 

Gene name
MEN1
Definition
(RefSeq) menin
  KO
K14970  menin
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04934  Cushing syndrome
cfa05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    483758 (MEN1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    483758 (MEN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cfa03036]
    483758 (MEN1)
Chromosome and associated proteins [BR:cfa03036]
 Eukaryotic type
  Histone modification proteins
   HMT complexes
    MLL-HCF complex
     483758 (MEN1)
SSDB
Motif
Pfam: Menin
Other DBs
NCBI-GeneID: 483758
NCBI-ProteinID: NP_001074977
Ensembl: ENSCAFG00000014185
VGNC: 43156
UniProt: A2SXS5
Position
18
AA seq 615 aa
MGLKAAQKTLFPLRSIDDVVRLFAAELGREEPDLVLLSLVLGFVEHFLAVNRVIPTNVPE
LTFQPSPAPDPPGGLTYFPVADLSIIAALYARFTAQIRGAVDLSLYPREGGVSSRELVKK
VSDVIWNSLSRSYFKDRAHIQSLFSFITGWSPTGTKLDSSGVAFAVVGACQALGLRDVHL
ALSEDHAWVVFGPNGEQTAEVTWHGKGNEDRRGQTVNAGVAERSWLYLKGSYMRCDRKME
VAFMVCAINPSIDLHTDSLELLQLQQKLLWLLYDLGHLERYPMALGNLADLEELEPTPGR
PDPLTLYHKGIASAKTYYRDEHIYPYMYLAGYHCRNRNVREALQAWADTATVIQDYNYCR
EDEEIYKEFFEVANDVIPNLLKEAASLLEAGEERPGEQTQGVQSQGSALQDPECFAHLLR
FYDGICKWEEGSPTPVLHVGWATFLVQSLGRFEGQVRQKVRIVSREAEAAEAEELWGEEA
REGRRRGPRRESKPEEPPPPKKPALDKGPGGGQGAMSGPPRKPPGTVPGTARGPEGGSTA
PAPAPAASPPPEGPVLTFQSEKMKGMKELLVATKINSSAIKLQLTAQSQVQMKKQKVSTP
SDYTLSFLKRQRKGL
NT seq 1848 nt   +upstreamnt  +downstreamnt
atggggctgaaggccgcccagaagacgctgttcccgctgcgctctatcgacgacgtggtg
cgcctgttcgctgcggagctgggccgagaggaaccggacctggtgcttctatccttggta
ctgggcttcgtggagcacttcctagctgtcaaccgcgtcatccccaccaatgtgcccgag
ctcaccttccagcccagccccgcgcccgacccacctggcgggcttacctacttccctgtg
gcggacctatccatcattgccgcgttgtatgcccgcttcaccgcccagatccgtggcgcc
gtggacctgtctctctacccgcgagagggaggtgtctccagccgagaactggtgaagaag
gtctccgatgtcatctggaacagcctcagccgttcctacttcaaggaccgggcccatatc
caatccctcttcagcttcatcacaggttggagcccgacaggcactaaactggacagctct
ggtgtggcctttgccgtggtgggggcctgccaggctctgggcctccgagatgtccacctg
gccctgtctgaggaccatgcctgggtagtgtttgggcccaacggagaacagacagctgag
gtcacttggcatggcaagggcaacgaagatcgcaggggccagacagtcaacgcgggtgtg
gctgagcggagctggctgtacctgaaaggatcatacatgcgctgtgaccgaaagatggaa
gtggcatttatggtgtgtgccatcaacccttccattgacctgcacactgactccctggag
ctgttgcagctgcagcagaaactgctctggctgctctatgacctgggacatctggaaagg
taccccatggcactggggaacctggcagatctggaggaactggagcccacccctggccgg
ccagacccactcactctctaccacaagggcattgcctcagccaagacctactaccgggat
gagcacatctacccctacatgtacctggctggctaccactgtcgcaatcgcaatgttcga
gaagccctgcaggcctgggctgatacagctactgtcatccaggactacaactactgccgc
gaagatgaggagatctacaaggagttctttgaagtagccaatgatgtcatccccaacttg
ctgaaggaggcagctagcctgctggaggctggcgaggagcggccaggggagcagacccag
ggggtgcagagccagggttctgccctacaggacccagagtgcttcgcccacctgctgcgg
ttctatgatggcatctgcaagtgggaagaaggcagccccacaccggtgctgcacgtgggc
tgggccaccttcctagtgcagtccctaggccggtttgagggacaggtacggcagaaggtg
cgcatcgtgagccgcgaggccgaggcggcggaggccgaggagctttggggcgaggaagcc
cgggaaggacggcggcgaggcccgcggcgtgagtccaagcccgaggagccgccgccacct
aagaagccggcactggacaaaggccctggtggaggccaaggggcgatgtcgggaccccct
cggaagcccccagggacagtccctggcactgcccgaggccctgaaggaggcagcacagct
ccggcgccagcgcccgcagcgtcgccaccaccagagggtccggtgctcactttccagagc
gagaagatgaagggcatgaaagagctgctggtggccaccaagatcaactcgagcgccatc
aagctgcagctcacggcacagtcacaagtgcagatgaagaagcagaaggtgtctacacct
agcgactacacgctttccttcctcaagcgccagcgcaagggcctctga

DBGET integrated database retrieval system