KEGG   Canis lupus familiaris (dog): 484046
Entry
484046            CDS       T01007                                 

Gene name
NOX3
Definition
(RefSeq) NADPH oxidase 3
  KO
K21422  NADPH oxidase 3 [EC:1.6.3.-]
Organism
cfa  Canis lupus familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfa04131]
    484046 (NOX3)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.3  With oxygen as acceptor
    1.6.3.-  
     484046 (NOX3)
Membrane trafficking [BR:cfa04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   NADPH oxidases
    484046 (NOX3)
SSDB
Motif
Pfam: NAD_binding_6 Ferric_reduct FAD_binding_8 FAD_binding_6 NAD_binding_1
Other DBs
NCBI-GeneID: 484046
NCBI-ProteinID: NP_001095303
Ensembl: ENSCAFG00000000589
VGNC: 43904
UniProt: A7E3L1
Position
1
AA seq 567 aa
MMGCWILNESLSVILVLSWLGVNLYLFIDTFCWYEEEESFLYTRVILGSTLAWARASAVC
LNFNCMLILLPISRNLISFMRGTSTCCRGLWRRQLDKNLKFHKLVAYGIAVNATIHIVAH
LCNLQRYHWSQSAEVQGLPATLSKLGNAPNESYLNPIRTFHTNTITELLTTIAGVTGLII
SLALVLIMTSSTESIRQVSYELFWYTHHVFIIFFIGLAIHGAGRIVRGQTPESQLLHNVT
FCRDHHAQWQKMAQCPMPQFSGKEPSAWKWVLGPVVLYACERIIRFWRFQQEVVITKVVS
HPSGVLELHMKKRNFKMAPGQYILVQCPSISWLEWHPFTLTSAPQEDFFSLHIRVAGDWT
EALWKAFGAEGQALKEPWSLPRLAVDGPFGTTLTDVFHYPVSVCIAAGIGVTPFASLLKS
IWYKCESQTQLKLSKVYFYWICRDPKAFEWFADLLLSLETLMSERGKAHFLSYHIFLTSW
DENQAVHIALHWDENTDVVTGLKQKTFYGRPNWSNEFRQLAYAHPSSSIGVFFCGPKALS
KTLQRMCHLYSSADPRGVHFYYNKESF
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgatggggtgctggattttgaatgaaagtctctctgtcatattagtactctcatggctg
ggagtcaatttatatctgtttattgacaccttctgttggtatgaagaggaggagtctttc
ctttacacacgagttattctgggttcaacgctggcttgggcgcgagcatctgcagtatgc
ctgaattttaactgtatgctaattctattaccaatcagtcgaaaccttatttcattcatg
agagggacaagtacctgctgcagaggactgtggaggagacagttagacaaaaatctcaaa
ttccacaaactggtcgcctatgggatagccgttaatgcaaccatccacatcgtggcacat
ttgtgcaacctgcagcgttaccactggagccagtcagctgaagtacagggccttccggct
acactttccaaacttggcaatgccccaaatgagagctacctcaaccccatccggaccttc
cacacaaacaccattactgaattgctaacaacaatcgcgggtgttactggcctgatcatc
tctctggctttagtcttgatcatgacctcttccaccgagtccatcagacaggtctcatat
gagttgttctggtacacacaccatgtgtttatcatcttctttattggtctggctatccat
ggggccggtcggattgttcgaggccaaactcctgagagtcagctgctgcacaacgtcacc
ttctgtagagaccaccatgctcaatggcagaagatggcccagtgccccatgcctcaattt
tctggcaaggagccttcggcttggaaatgggttttaggccctgtggtcttatatgcgtgt
gaaagaataattaggttttggcggtttcaacaagaagttgtcattaccaaggtggtgagc
catccgtctggagttctagaacttcacatgaaaaagcggaactttaaaatggcaccgggg
caatacatcctggtacagtgcccatccatatcgtggctggaatggcaccccttcaccctc
acctccgcccctcaggaagacttcttcagtttgcacatccgggtagccggggactggaca
gaagctttatggaaggcctttggtgcagagggacaagccctgaaggaaccctggagcctg
ccaaggctggccgtggacgggccatttggaaccaccctgacggacgtatttcactatcca
gtgagcgtgtgcatcgctgcaggaataggggtcactcccttcgcctctcttctgaaatcc
atatggtacaaatgtgagtcacaaacccagctgaagctgagcaaggtgtatttctactgg
atttgccgcgatccaaaggcttttgagtggtttgctgatctcttactctcactggaaaca
cttatgagtgagcgagggaaagctcattttctgagctatcatatatttctcaccagctgg
gatgaaaatcaggctgttcacattgctttacattgggatgaaaatactgatgtggtcacg
gggttaaagcagaaaacattctatggaagacccaactggagcaatgagttccggcagctg
gcctatgctcaccccagcagcagcattggcgtgtttttctgtggacccaaagctctctcc
aagacacttcaaaggatgtgccacttatattcctcagccgacccccggggcgtccatttt
tattacaacaaagaaagcttctag

DBGET integrated database retrieval system