KEGG   Canis lupus familiaris (dog): 484142
Entry
484142            CDS       T01007                                 

Gene name
DAPK1
Definition
(RefSeq) death-associated protein kinase 1
  KO
K08803  death-associated protein kinase [EC:2.7.11.1]
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04140  Autophagy - animal
cfa05200  Pathways in cancer
cfa05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    484142 (DAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    484142 (DAPK1)
  09162 Cancer: specific types
   05219 Bladder cancer
    484142 (DAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfa01001]
    484142 (DAPK1)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     484142 (DAPK1)
Protein kinases [BR:cfa01001]
 Serine/threonine kinases: CAMK group
  DAPK family
   484142 (DAPK1)
SSDB
Motif
Pfam: Pkinase Ank_2 Ank_5 Ank_4 Ank PK_Tyr_Ser-Thr Ank_3 Death Kdo COR RIO1 AAA_23 APH Choline_kinase AAA_16 ABC_tran
Other DBs
NCBI-GeneID: 484142
NCBI-ProteinID: NP_001184086
Ensembl: ENSCAFG00000001316
VGNC: 39770
UniProt: E2JE41
Position
1
AA seq 1430 aa
MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSRED
IEREVSILKEIQHPNVITLHEVYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFL
KQILNGVYYLHSLQIAHFDLKPENIMLLDRNVPKPRIKIIDFGLAHKIDFGNEFKNIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYEFEEEY
FSNTSALAKDFIRRLLVKDPKKRMTIQDSLQHPWIKPKDTQQALSRKASAVNMEKFKKFA
ARKKWKQSVRLISLCQRLSRSFLSRSNMSVARSDDTLDEEDSFVMKAIIHAINDDNVPGL
QHLLGSLSNYDVNQPNKHGTPPLLIAAGCGNIQILQLLIKRGSRIDVQDKGGSNAIYWAS
RHGHVDTLKFLNENKCPLDVKDKSGETALHVAARYGHADVVQLLCSFGSNPNFQDKEEET
PLHCAAWHGYYSVAKALCEAGCNVNSKNREGETPLLTASARGYHDIVECLSEHGADLNAS
DKDGHIALHLAVRRCQMEVIQTLISQGCSVDFQDRHGNTPLHVACKDGNVPIVVALCEAS
CNLDISNKYGRTPLHLAANNGILDVVRYLCLAGANVEALTSDGKTAEELAKSEQHEHVAG
LLARLRKDAHRGLFIQQLRPTQNLQSRIKLKLFGHSGSGKTTLVESLKCGLLRSFFRRRR
PRLSSTNSTRFPPSPLASKPAVSVSISNLYPGCEHVSVRSRSMMFEPGLTRGTLGVLVAP
PPHLHCATDDQSTKAIDIQNAYLNGVGDFSVWEFSGNPVYFCCYDYFAANDPTSIHIIVF
SLEEPYEIQLNQVIFWLNFLKSLVPVEEPIAFGGKLKNPLHVVLVATHADIMNVPRPAGG
EFGYDKDTSLLKEIKNRFGNDLHISNKLFVLDAGASGSKDMKVLRSHLQDIRSQIVSVCP
PMTHLCEKIISTLPSWRKLNGPNQLMSLQQFVYDVQDQLNPLAREGDLRRIAQQLHSAGE
INIMQSETVQDVLLLDPRWLCTNVLGKLLSVETPRALHHYRGRYTVEDVQRLVPDSDVEE
LLQILDAMDICARDLSSGTMVDIPALIKTDNLHRSWTDEEDEGRVYGGVRIVPVEYLTPF
PCGIFHKVQVNLCRWIHQQSAEGDADIRLWVNGCKIANRGAELLVLLVNHGQGIEVQVRG
LETEKIKCCLLLDSVCSTMENVMATTLPGLLTVKHYLSPQQLREHHEPVMIYQPRDFFRA
QTLKETSLTNTMGGYKESFSSIMCFGCHDVYSQASLGMDIHASDLNLLTRRKLCRLLDPP
DPMGKDWCLLAMNLGLPDLVAKYNTNNGAPKEFLPSPVHALLREWTSYPESTVGILMSKL
RELGRRDAADFLLKASSVFKINLDGNGQETYDSSCNSGTSYNSISSVVSR
NT seq 4293 nt   +upstreamnt  +downstreamnt
atgactgtgttcaggcaggaaaacgtggatgattactacgacaccggcgaggagctcggc
agtgggcagtttgcagtcgtgaagaaatgccgggagaagagcactggtctccagtatgcc
gccaagtttatcaagaagaggcggacgaaatccagccggcggggcgtgagccgcgaggac
atcgagcgggaggtcagcatcctgaaggagatccagcaccccaacgtcatcaccctacat
gaggtctacgagaacaagaccgacgtcatcctgattctagaactagttgcaggtggtgag
ctgtttgacttcttggctgaaaaggaatctctgactgaagaggaagcaacggagtttctc
aaacaaattcttaatggcgtttactacctgcactcccttcagattgcccattttgatctt
aagcctgaaaacataatgcttttggatagaaatgtccctaaacctcgcatcaagatcatt
gattttgggttggcccataaaattgactttggaaatgaattcaaaaacatatttgggaca
ccagagtttgttgctcctgagatcgtcaactatgaacctctcggtcttgaggcagatatg
tggagtattggggtaataacctatattctcttaagtggagcctccccatttcttggagac
actaagcaagaaacgttagcaaatgtatccgctgtcaactatgaatttgaggaagaatac
ttcagtaataccagtgccctagccaaagatttcataagaagactcctcgtcaaggatcca
aagaagagaatgacaattcaagatagtttgcagcatccctggatcaagcctaaagatacc
caacaagcactcagtagaaaggcatcggcagtcaacatggagaagttcaagaagttcgca
gcccggaaaaagtggaaacaatccgttcgcttgatatcactgtgccaaagattatccagg
tcattcttgtccagaagtaacatgagtgttgccagaagtgatgatactctggatgaagaa
gactcatttgtgatgaaagccatcatccacgccatcaatgatgacaatgtcccaggcctg
cagcacctcctgggctcattgtccaactatgatgttaatcaacccaacaagcatgggaca
cctccgttactgatcgctgctggctgtgggaatattcaaatactacagttgctcattaaa
agaggctcaagaattgatgtccaggataagggcggatccaatgccatctactgggcttct
cggcatggccacgtcgataccctgaaatttctcaatgagaacaaatgccctttggatgtt
aaagataagtctggagagacagcccttcacgtggcagctcgctatggccacgccgacgtg
gttcagttactgtgcagctttggctctaatcccaatttccaggacaaggaagaagaaacc
cccctgcactgtgctgcctggcacggctattactccgtggccaaagccctctgtgaagcc
ggctgcaatgtgaacagtaagaatagagaaggagagacgcccctcctgacggcctctgcc
aggggctaccatgacatcgtggagtgtctctcggaacacggagctgaccttaatgcctct
gacaaggatggacacatcgctcttcaccttgctgtgagaaggtgtcagatggaggtcatc
cagactctcatcagccagggatgttctgtcgacttccaagaccggcacggcaacacccca
ctccatgtggcctgcaaggatggcaacgtgcctatcgtggtggccctctgtgaagccagc
tgcaacttggatatctccaacaagtacggccggacgcctctgcaccttgcagccaacaac
gggattctggacgtagtccgctacctctgcctggcaggcgccaatgtggaggcgctgacc
tcggatgggaagacagcagaagagcttgctaagtcagaacagcatgaacatgtagcaggt
ctgcttgcaagactccgaaaggatgctcaccggggactcttcatccagcaactgcgaccc
acgcagaacctccagtccagaatcaagctgaagctgttcggccactctggctctgggaag
accaccctggtggaatctctcaagtgtgggctgctgagaagcttcttcaggagacgccgg
cccagactctcctccaccaactccaccaggttcccaccgtcgcccctggcgtccaagcca
gcagtctctgtgagcatcagcaacctgtatccgggctgcgagcacgtgagtgtaaggagc
cgcagcatgatgttcgagccaggcctcaccagagggaccctgggggtgttggtggcccca
cccccgcacctgcactgtgcgactgacgaccagtccacgaaggccattgacatccagaat
gcttacctgaacggagtcggtgatttcagtgtgtgggaattctccggcaatcctgtatac
ttctgctgttatgactactttgctgcaaacgatcccacgtccatccacatcatcgttttc
agcctggaagagccctacgagatccagttgaaccaagtgattttctggctgaatttcctg
aagtctctggtgccagttgaagaacccatagcattcggcggcaagctgaagaacccattg
cacgtcgtcctggtggccacccacgctgacatcatgaacgtgcctcggccagcgggaggc
gagttcggatatgacaaggacacgtccttactgaaggagatcaagaacaggtttgggaac
gatctccatatttcaaacaagctctttgttctggatgctggcgcttcgggctctaaggac
atgaaagtacttcgaagtcacctgcaagacattcggagccagattgtctcggtttgcccc
ccgatgacccacctgtgtgagaagatcatctccacgctgccttcctggaggaagctcaac
gggcccaaccagctcatgtctctgcagcagtttgtgtacgatgtgcaagaccagctgaac
cccctggctagagagggagacctccggcgcatagcccagcagcttcacagtgctggcgag
atcaacatcatgcagagtgaaacggtccaggatgtgttactcctggacccccgctggctc
tgcaccaacgtcctggggaagctgctctccgtggagaccccccgggccctgcaccattac
cggggccgctacaccgtggaggacgtccagcgcctggtgcccgacagtgacgtggaggag
ctactgcagatcctcgatgccatggacatctgtgcccgagacctgagcagcgggaccatg
gtggacatccctgccctgatcaagacggacaacctgcaccgctcctggacagacgaggag
gatgaggggagggtctacgggggcgtgcgcatcgtccctgtggagtacctcacccccttc
ccgtgcggcatctttcacaaggtccaggtgaacctctgccggtggatccaccagcagagc
gcagagggagatgcggacatccgcctgtgggtgaatggctgcaagatcgccaaccgtggg
gccgagctgctggtgcttctggtcaaccatggccagggcatcgaggtccaggtgcgaggg
ctggagacggagaagataaagtgctgcctcctgctggactccgtgtgcagcaccatggag
aacgtcatggccaccacgctcccgggcttgctgaccgtgaagcattacctgagcccccag
cagctgcgagagcaccacgagcctgtcatgatctaccagccgcgagactttttccgtgcg
cagaccctgaaggagacctcactgaccaacaccatgggtgggtacaaggagagcttcagc
agcatcatgtgcttcgggtgtcacgacgtgtactcacaggccagcctggggatggacatc
catgcctcagatctgaacctcctgacccggaggaaactctgtcgtctgctggacccacct
gatcccatggggaaggactggtgccttctcgccatgaacttgggtctccctgacctcgtg
gccaagtacaacaccaataatggggcccccaaggagttcctccccagcccggtgcacgcc
ctactccgggagtggacctcctatcccgagagcacagttggcatcctcatgtccaaactg
agggagctggggcgtcgggacgcagcggactttctgctgaaggcatcctctgtgttcaaa
atcaacctcgacggcaatggccaggaaacctacgactcaagctgcaacagcggcacatct
tataattccattagctcggtcgtgtcccggtga

DBGET integrated database retrieval system