KEGG   Canis lupus familiaris (dog): 484208
Entry
484208            CDS       T01007                                 

Gene name
PHF2
Definition
(RefSeq) lysine-specific demethylase PHF2 isoform X1
  KO
K19414  lysine-specific demethylase PHF2 [EC:1.14.11.-]
Organism
cfa  Canis lupus familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cfa03036]
    484208 (PHF2)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.-  
     484208 (PHF2)
Chromosome and associated proteins [BR:cfa03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    484208 (PHF2)
SSDB
Motif
Pfam: JHD JmjC Cupin_8 Alginate_lyase2 Med13_C
Other DBs
NCBI-GeneID: 484208
NCBI-ProteinID: XP_005616040
Ensembl: ENSCAFG00000002253
VGNC: 44484
UniProt: J9P6K3
Position
1
AA seq 1096 aa
MHTHQLASLPSSWPDQGCVGVEEEEAPDIDIYHCPNCEKTHGKSTLKKKRAWHKHGPGQT
PDVKPVQNGSQLFIKELRSRTFPSAEDVVVRVPGSQLTLGYMEEHGFAEPILVPKKDGLG
LAVPAPTFYVSDVENYVGPERSVDVTDVAKQKDCKMKLKEFVDYYYSTNRKRVLNLTSLE
FSDTRMSSFVEPPDIVKKLSWVENCWPDDALLAKPKVTKYCLICVKDSYTDFHIDSGGAS
AWYHVLKGEKIFYLIKPASANISLYERWQSAANHSEMFFADQVDRCYKCTVKQGQTLFIP
SGWIYATLTPVDCLAFAGHFLHSLSVEMQMRAYEVERRLKLGSLTQFPNFETACWYMGKH
LLEAFRGSHKSGKQLPPHLVQGAKILNGAFRSWTKKQALAEHEDELPEHFKPSQLIKDLA
KEIRLSENASKASRPEVTPAVPTDEVCFGDREKEEPPSPIEASPPRSFLEKVSKKKIPKT
VKMPKPSKVPKSPKPPKPPKPPKPLKLKDGGKKKGKKCRGAASPTIPNLDLLEAHTKEAL
TKIEPPKKGKATKSVLSVPNKEAISSQNDVERLEIREQTKSKSEAKWKYKNSKPDSLLKM
EEEQKLEKCPLSGNRDPKFSFSFNRRLLSPKALKPQPSPGVFGAMQSFKEDKPQPVRDEY
EYVSDDGELKIDEFPIRRKRTAPKRDLSFLLDGKEPLPTPVTKPKLESALYKSDDSSDEG
SLHIDTDTKPARNAKVKKEGAGSAAGILDLLQASEEVGALEYNPNSQPPASPSPPEAIQG
MLSMANLPASDSCLQTTWGAGQTKGSSLAAHGARKNGGGSKSAGKRLLKRAAKNSMDLDD
YEEEQDHLDACFKDSDYVYPSLESDEDSPVFKSRSKRRKGSDDAPYSPTARVGPSVPRQD
RPVREGTRVASIETGLAAAAAKLSQQEEQKSRKKKNTKRKLAPNTPSPSASTTSASTTSA
STTSASTTSASTTSASTTSASTTSASTTPASTTPASTSTASSQASQEGSSPEPPPEAHSS
SLADHEYTAAGAFAGAQAGRASQPMAPGVFLTQRRPSASSPNNTAAKGKRTKKGMATAKQ
RLGKILKIHRNGKLLL
NT seq 3291 nt   +upstreamnt  +downstreamnt
atgcacacccaccagctggcatcccttccaagttcatggccggaccaaggctgtgtggga
gtggaagaggaggaggccccagacatcgacatataccactgcccgaactgcgagaaaacc
cacgggaagtccaccttgaagaagaagcgggcctggcacaaacacggcccagggcagaca
cccgacgtgaagcccgtgcagaatggcagccagctcttcatcaaggagctgcggagtcgg
accttccccagcgcggaagacgtggtggtccgcgtgccgggcagccagctcacactgggc
tacatggaggagcatggctttgctgagcccatcctcgtccccaagaaagatgggttgggc
ctggcagtcccggcccccaccttctacgtcagcgatgtggagaactacgtgggcccagag
cggagcgtggatgtgacagacgtggccaagcagaaagactgcaaaatgaagctgaaggag
tttgtggactactactacagcaccaaccgcaagcgggtgctcaacctcaccagcctcgag
ttctctgacaccaggatgtccagcttcgtggagccacccgacatcgtcaagaagctgtca
tgggtggagaactgctggcccgatgacgcgctgctggccaagcccaaggtgaccaagtac
tgcctcatctgcgtgaaggacagctacaccgacttccacatcgactcgggtggtgcctcc
gcctggtaccacgtgctcaagggggagaagatcttctatctcatcaagccggcctcggcc
aacatctccctgtatgagcgctggcagtcagccgcgaaccacagtgagatgttctttgcc
gaccaggtggacaggtgttacaagtgcactgtcaagcagggccagacgctcttcatcccc
tcaggctggatttacgccacgctcacgcccgtggattgcctggccttcgcgggacatttc
ctccacagcctgagcgtggagatgcagatgagagcatacgaagtagaaaggaggttgaaa
ctgggtagcctgactcagtttcccaactttgaaactgcctgctggtacatggggaagcac
ctgctggaggcgttcagaggttcccacaagtctgggaagcagctgccccctcatttagtc
caaggagctaaaattctcaatggtgcttttagatcatggacgaaaaagcaggctttggcg
gagcatgaggacgagctcccagagcacttcaaaccttcccagctcatcaaagacctcgcc
aaagagatccggctcagcgagaatgcctccaaggcctcccgacctgaagtgaccccagct
gtccccacggatgaggtctgctttggggaccgggagaaagaggagcccccatcccccatt
gaagccagtcctcctcgatccttcctggagaaagtgtccaaaaaaaagattcccaaaacc
gtgaagatgcccaagccgtccaaagttcccaagtcccccaaaccccccaagcccccgaag
ccccccaaaccgctgaagctcaaggatggaggcaagaaaaaagggaagaagtgcaggggg
gcggcctcgcccaccatccccaacctggacctgctggaggcacacaccaaggaggcactg
accaaaattgagcctccgaagaaaggcaaggccacaaagagcgtcctgagcgtgcccaac
aaggaggcgatcagctcacagaatgatgtggagaggctagaaatccgagagcaaactaaa
agcaagtcagaagccaaatggaagtacaagaacagcaaacctgattccctgctgaagatg
gaggaggagcagaagctggagaagtgtcctttgtcggggaacagggaccccaagttctca
ttttcctttaacaggaggctgctgagccccaaggccctgaagccgcagcccagcccgggc
gtgtttggggccatgcagagcttcaaggaggacaagccacagccggtgcgggacgagtac
gagtacgtgtcggacgacggggagctcaagattgacgagtttcccatccggaggaagagg
accgcccccaagagagacttgtctttcttactggatgggaaggagccactgcccacgccc
gtcacgaagccaaagctggagtccgcactctacaagagcgacgactcctctgacgagggc
tcactgcacattgacacagacaccaagcctgcccgcaacgccaaagtgaagaaggagggt
gcgggctcggcggcgggcatcctggacctcctgcaggccagcgaggaggtgggagccctt
gagtacaaccccaacagccagcccccggcctcccccagcccaccagaagccattcaggga
atgctgtccatggccaacctgcccgcctctgactcctgcctgcagaccacatggggtgcc
ggccagaccaagggcagctcattggcggcccacggggcccggaagaacgggggtggcagc
aagagcgcgggcaagcggctgctgaagagggcggccaagaacagcatggacctggacgac
tacgaggaggagcaggaccacctggacgcctgcttcaaggactcggattacgtttatccc
tctctggagtcggatgaggacagtcccgtcttcaagtcccggtccaagaggaggaaaggc
tctgacgacgctccctacagccccacagcaagggttgggccatcggtgccgaggcaggac
aggcctgtgcgcgagggcaccagggtggcctccatcgagactgggctggcagctgctgca
gccaagctgtcccagcaggaggagcagaagagcagaaagaaaaagaacaccaagaggaag
ctggctcccaacacgccctccccctccgcctccaccacctctgccagcaccacgtctgcc
agcaccacgtctgccagcaccacgtccgcctccaccacctcggcctccaccacctcggcc
tctaccacctcggcctccaccaccccggcctccaccaccccggcctctaccagcacagcc
agtagccaggcctcccaggagggcagctcacctgagcccccgcctgaggcacatagcagc
agcctggcggaccacgaatacacggcggctggagcctttgcaggggcgcaggctggccga
gcctcccagcccatggcccccggggtcttcctcacgcagaggcggccctccgcatcatcc
cccaacaacaccgctgccaaaggaaaacgtacaaagaagggcatggccaccgccaagcag
aggcttgggaaaattttgaaaattcatcggaatggaaaactgctcctttaa

DBGET integrated database retrieval system