KEGG   Canis lupus familiaris (dog): 484238
Entry
484238            CDS       T01007                                 

Gene name
ZNF606
Definition
(RefSeq) zinc finger protein 606 isoform X2
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    484238 (ZNF606)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cfa03000]
    484238 (ZNF606)
Transcription factors [BR:cfa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    484238 (ZNF606)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 Zn-ribbon_8 zf-C2H2_jaz zf_C2H2_13 HalOD2 zinc_ribbon_15 zf-AN1 DUF3268
Other DBs
NCBI-GeneID: 484238
NCBI-ProteinID: XP_013969905
Ensembl: ENSCAFG00000029776
VGNC: 48773
UniProt: J9NX34
Position
1
AA seq 853 aa
MLPRSLLLFLWIGCLFCYWFFFRERTTFVFSIFVVRLVLQLHSVNESPESSAPGRAPGPL
ICGMAAINPWASWGILTDQSWGMAAVDPWASWALCPQDSAWHLEENREEEKRATGLPTAE
VQEPVTFKDVAVDFTQEEWGQLDPVQRTLYRDVMLETYGHLLSVGNQIAKPEVISLLEQG
EEPWSVEQAYPQSTCSEWMRNLESKALIPTQSIFEEEQSHRMKLERYIWDDPWFSRLEVL
GCKDQLEMYHMNQSTAMRQMFFMQKQVLSQRGSEFCELGAECSQNLNFVPSQRVSQIEHF
YKPDTNAESWQCNSIMYADKITCGSHDYDKAFHQSIQPIQPERIQTEDNLLKCADAVKSF
NHFLHFGDHKGMHTGEKLYEYKECHQIFNQSPSFNEHPRLHIGENQYDYKEYENIFYFSS
FMEHQKIGTVEKAYKYNEWEKVFGYDSFLTQHTSTYTSEKPYEYNECGTSFIWSSYLIQH
KKTHTGEKPYECDKCGKVFRNRSALTKHERTHTGIKPYECNKCGKAFSWNSHLIVHKRIH
TGEKPYVCNECGKSFNWNSHLIGHQRTHTGEKPFECTECGKSFSWSSHLIAHMRMHTGEK
PFKCDECEKAFRDYSALSKHERTHSGAKPYKCTECGKSFSWSSHLIAHQRTHTGEKPYNC
QECGKAFRERSALTKHEIIHSGIKPYECNKCGKSCSQMAHLVRHQRTHTGEKPYECNKCG
KSFSQSCHLVAHRRIHTGEKPYKCNQCERSFNCSSHLIAHRRTHTGEKPYRCNECGKAFN
ESSSLIVHLRNHTGEKPYKCNHCEKAFCKNSSLIIHQRMHSGEKRFICNDCGKAFSGHSA
LLQHQRNHSEEKL
NT seq 2562 nt   +upstreamnt  +downstreamnt
atgctccctagaagtcttctgttgtttctatggataggctgccttttttgttactggttc
ttcttcagagaaaggaccacttttgtgttttctatttttgtggttaggttggtactgcaa
ttgcattccgtgaatgaatcacctgaatcaagtgcacctgggagggcacctggtccattg
atctgtgggatggcagccatcaacccttgggcctcctggggtatccttacagaccagtcc
tggggaatggcggctgttgacccgtgggcctcctgggctctatgtcctcaggactctgcc
tggcatttggaagagaaccgtgaggaggagaagagggccactgggctcccgacagccgag
gtccaggaaccagtaaccttcaaggatgtagctgtggacttcacccaggaggagtggggg
cagctggaccctgttcagaggacgctgtaccgtgatgtgatgctggagacctatgggcat
ctactctctgtggggaatcagattgccaagccggaagtcatctctctattggagcaagga
gaggagccctggtcagtggaacaagcatatcctcaaagcacttgttcagaatggatgaga
aatcttgaaagcaaagcattgatcccaacccaaagcatttttgaagaagaacaatcccat
aggatgaagttggaaagatacatatgggatgatccttggttctccaggttagaagtcttg
ggatgtaaagaccaattagaaatgtatcacatgaaccagagtacagctatgaggcaaatg
ttcttcatgcaaaagcaagtactctctcaaagaggttctgaattctgtgaacttggagca
gagtgtagccagaacttaaattttgttccatctcagagagtttctcaaatagaacatttc
tataagcctgatacaaatgctgaaagctggcagtgtaattcaataatgtatgcagataag
attacctgtggaagtcatgattatgacaaagccttccaccaatccatacaacctattcag
cctgaaaggatccaaactgaagataatcttctcaagtgtgcagatgctgttaaatctttc
aatcattttctacattttggtgatcataagggaatgcatacaggagaaaaactctatgaa
tataaggaatgccatcaaatctttaaccagagcccttcatttaatgaacatccacgactt
catattggagaaaaccagtatgattacaaagaatatgagaatatcttttatttctcatca
tttatggaacatcaaaaaattggtactgtagagaaagcatataaatacaatgaatgggag
aaagtctttgggtatgattcattccttactcaacatacaagcacttacacctcagagaaa
ccctatgaatataatgaatgtgggacatctttcatctggagctcttaccttatccagcat
aagaaaactcatactggagagaaaccctatgaatgtgataaatgtggaaaagtgtttagg
aatcgttcagcccttactaaacatgaacggactcacactggaataaagccctacgaatgt
aacaaatgtggaaaagccttcagctggaattctcatcttattgtacataaaagaattcat
acaggagaaaaaccttatgtatgtaatgaatgtgggaaatctttcaactggaactcccat
cttattggacatcagagaactcatactggagagaaaccttttgaatgtactgaatgtggg
aagtctttcagctggagctcccatcttattgcccatatgagaatgcatactggagagaag
ccctttaaatgtgatgaatgtgaaaaagctttcagggattactcagcccttagtaagcat
gaaagaactcactctggagcaaaaccatataaatgtacggaatgtggaaaatcctttagc
tggagctcccatcttattgcccatcagagaactcacacaggtgaaaaaccctacaactgt
caggaatgtggcaaagcattcagagaacgctcagcccttactaaacatgaaataattcat
tctggaatcaagccttatgaatgtaataaatgtggaaaatcctgcagccagatggctcac
cttgttagacatcaaaggactcatactggagaaaagccctatgagtgtaataaatgtgga
aaatccttcagccagagctgtcaccttgttgctcatcggagaattcacactggtgagaaa
ccctataaatgtaatcaatgtgaaagatcctttaactgtagctctcaccttattgcgcat
cggagaactcatactggagagaaaccatatagatgtaatgaatgtgggaaggcatttaat
gagagttcttccctaattgtacatctaagaaaccatactggagaaaaaccatacaaatgc
aatcattgtgagaaagctttctgtaagaattcttctcttattattcatcagagaatgcat
agtggagagaaacgctttatatgcaatgactgtggaaaagcctttagtggtcactcagcc
ctacttcaacatcagagaaatcatagtgaagagaaactgtga

DBGET integrated database retrieval system