KEGG   Canis familiaris (dog): 484401Help
Entry
484401            CDS       T01007                                 

Gene name
SPHK2
Definition
(RefSeq) sphingosine kinase 2 isoform X2
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00600  Sphingolipid metabolism
cfa01100  Metabolic pathways
cfa04020  Calcium signaling pathway
cfa04071  Sphingolipid signaling pathway
cfa04072  Phospholipase D signaling pathway
cfa04370  VEGF signaling pathway
cfa04371  Apelin signaling pathway
cfa04666  Fc gamma R-mediated phagocytosis
cfa05152  Tuberculosis
Module
cfa_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    484401 (SPHK2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    484401 (SPHK2)
   04371 Apelin signaling pathway
    484401 (SPHK2)
   04020 Calcium signaling pathway
    484401 (SPHK2)
   04072 Phospholipase D signaling pathway
    484401 (SPHK2)
   04071 Sphingolipid signaling pathway
    484401 (SPHK2)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    484401 (SPHK2)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    484401 (SPHK2)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     484401 (SPHK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 484401
NCBI-ProteinID: XP_005616401
Ensembl: ENSCAFG00000003961
VGNC: 46737
UniProt: J9P106
Position
1
AA seq 674 aa AA seqDB search
MASGEGTSGPAPIPSLESRRPDAQRPDQELTWSWGHRPRSALDRAEAMAPPPPPPLAAST
PLLHGEFGSYPARGSRFALTLTPQALHIQRLRPKPEARPRGGLVLLAEVSGCCTLRSRSL
SDSAAYFCIYTYPQGRRGGRLGGRRRAPRTFRADGAATYEENRAEAQRWATALMCLLRGV
PLPGDGEITPELLPRPPRLFLLVNPFGGRGLAWQWCKNHVLPMISEAGLSFNLIQTERQN
HARELVQGLNLSEWDGIVTVSGDGLLFEVLNGLLGRPDWEEAVKTPVGILPCGSGNALAG
AVNQHGGFEPALGVDLLLNCSLLLCRGGSRPLDLLSVTLASGSRCFSFLSVAWGFVSDVD
IQSERFRALGSARFTLGTVLGLANLHTYRGRLSYLPAAVEPASPTPAHGLPRAKSELTLA
PAPAPAPPVAHSPLHRSVSDLPLPLPMPQPALTSPGSPEPLPILSLNGGGPELAGDWGGA
GDAPLSPDPLLPSPPSSPKAALLSPITEGVPEMPASSGLPPPTPDAPEAISTGGPPDHLL
PPLGTPLPPGWVTLEGDFVLMLAISPSHLGADLVAAPHARFDDGLVHLCWVRGGISRAAL
LRLFLAMERGSHFNLGCPQLGYAAARAFRLEPLTPRGVLTVDGEQVEYGPLQAQMHPGLG
TLLTGPPGCPGREP
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atggcctctggggaggggacctcaggcccggctcccatcccctccctggagagcaggcgg
ccagacgcccagaggccagaccaggagctgacctggagctggggccacaggcctagaagc
gccctggacagggccgaggccatggcccccccaccgccgccaccattggccgccagcacc
ccgctcctgcatggcgagtttggctcctacccagcccgcggctcccgcttcgccctcact
ctcacaccacaggccctgcacatacagcggctgcgtccgaagcctgaagcccggccccgg
ggcggcttggtcctgttggccgaggtgtctggttgctgcacccttcggagccgcagcctc
tcagactcagcagcctacttctgcatctacacctacccgcagggccggcgcgggggccgg
cttgggggccggcgcagagcccctcgcacctttcgggccgacggggcagccacctacgag
gagaaccgcgctgaggcccagcgctgggccactgccctcatgtgtctgctccgtggagtg
ccactgcctggggatggggaaataacccctgagcttctgccaaggccaccccgattgttt
ctactggtcaatcccttcggggggcggggtctggcctggcagtggtgtaagaaccacgtg
ctgcccatgatctctgaagccgggctgtccttcaacctcatccagacagaacggcagaac
cacgcccgggagctggttcagggactgaacctgagtgagtgggacggcatcgtgacagtc
tcaggagacgggctgctgtttgaggtgctgaacgggctcctaggccgccctgattgggaa
gaagctgtgaagacacctgtgggcattctcccctgtggctcaggcaatgccctggctgga
gctgtgaaccagcatggggggtttgaacctgccctgggtgtcgacctgctgctcaactgc
tcactgctcctctgccggggtggcagccgcccgctggatctgctctctgtgacactggcc
tcgggttcccgctgtttctccttcctgtccgtggcctggggcttcgtgtcagatgtggac
atccagagcgagcgcttcagggccctgggcagtgcccgcttcacactgggcacggtgctg
ggccttgccaacctgcacacataccgcggacgcctctcctacctccctgccgctgtggaa
cctgcctcacccacccctgctcacggcctgccccgtgccaagtcagagctgactctggcc
ccagccccggccccagccccacccgtggcacactcacccctgcatcgctcggtatctgac
ctgcccctgccactgcccatgccccagcctgccctgacctcccctggctcacctgagccc
ctgcccatcctgtctctcaacggtgggggcccagagttggctggggactggggtggggct
ggggatgccccactgtccccagacccactgctgccctcaccacctagttcccctaaggca
gctttattgtcccccatcaccgagggggttccagaaatgccagcctcctctgggctccca
cctcccacccctgatgccccggaagcgatctctactgggggcccacctgaccacctgctc
cctcctctgggcacccccctccccccaggctgggtgacgctggagggggactttgtgctt
atgttggccatctcacccagccacctgggggctgatctggtggcagctccccacgcgcgc
tttgacgacggcctggtgcacctgtgctgggtgcggggcggcatctcgcgagctgcgctg
ctgcgcctttttctggccatggagcgagggagccacttcaacctgggctgtccgcagctg
ggctatgccgcggcccgtgccttccgcctcgagcctctcacgcctcggggcgtgctcact
gtggacggagagcaggtggagtatgggccactgcaggcgcagatgcatccaggcctgggt
acactgctcaccgggcctccgggctgcccaggtcgggagccttga

DBGET integrated database retrieval system