KEGG   Canis familiaris (dog): 484491Help
Entry
484491            CDS       T01007                                 

Gene name
CYP2S1
Definition
(RefSeq) cytochrome P450 2S1 isoform X2
  KO
K07420  cytochrome P450 family 2 subfamily S polypeptide 1 [EC:1.14.14.1]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00830  Retinol metabolism
cfa00980  Metabolism of xenobiotics by cytochrome P450
cfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    484491 (CYP2S1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    484491 (CYP2S1)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     484491 (CYP2S1)
Cytochrome P450 [BR:cfa00199]
 Cytochrome P450, animal type
  CYP2 family
   484491 (CYP2S1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 484491
NCBI-ProteinID: XP_022281186
VGNC: 50356
Position
1
AA seq 428 aa AA seqDB search
MEAAGTWTLLLALLLLLLLLALARPRTRGHLPPGPPPLPLLGNLLQLRPGALYSGLLRLS
KKYGPVFTVYLGPWRRVVVLVGHEAVQEALGGQAEEFSGRGMLATLDGTFGGHGVFFSNG
ERWRQLRRLTTLALRDLGMGKREGEELIQAEAQSLVEAFQGTVGRPFDPSLLLAQATSNI
ICSLTFGLRFPYEDKEFQAVVQAAGGTVLGVSSPWGQTYEMFSWLLQHLPGPHTQLLSHL
SVLATFAVQQVQRHKESLDTSGPPHDVVDAFLLKMAKEEQDPNTELTDKNLLMTVIYLLF
AGTVTVSTTVRYTLLLLLKYPQVQERVREELSRELGAGRAPGLGDRARLPYTDAVLHEAQ
RLLALVPMGVPRALARTTCFRGAPRSSPSLALSCMILRSLMSQKNSIQIDSWMQTDGSRS
RRHSCPSP
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggccggcacctggacgctgctgctggcgctgctgctgctgctgctgctgctg
gcgctggcgcggccccggacccgcggccacctgccccccgggcccccgccgctgccgctg
ctggggaacctcctgcagctgcggcccggggcgctgtactcggggctcctgcggctgagt
aagaagtatggcccggtgttcaccgtgtacctgggaccctggcggcgcgtggtggtcctg
gttgggcacgaggctgtgcaggaggccctgggaggtcaggctgaggagttcagtgggcgg
gggatgttggcaacgctggacgggacctttggcggccatggggttttcttctccaatggg
gagcggtggaggcagctgaggagattgaccacgctggccctgcgggacctgggcatgggg
aagcgagaaggcgaggagctgatccaggccgaggcccagagtctggtggaggcattccag
gggacagtaggacgcccatttgacccctccctgctgctggctcaggccacctctaacatc
atctgctccctcaccttcggcctccgcttcccctacgaggacaaggagttccaggccgtg
gtccaggcggccggcggcacagtgctgggggtcagctccccctggggccagacctacgag
atgttctcctggctcctgcagcacctgcccggcccccacacacagctcctcagccacttg
agtgtcctggccaccttcgccgtccagcaggtacagagacacaaggagagcctggacacc
tcgggccccccacacgacgttgtggatgccttcctgctgaagatggcaaaggaggagcaa
gacccgaacacagaactgacggacaaaaacttgctgatgacggtcatttatctgctattc
gccgggacggtcaccgtcagcaccacggtccgctacaccctcctgcttctgctgaagtac
cctcaggtccaagagcgtgtgcgggaggagctgagccgagagctgggggccggccgtgca
ccgggcctgggggaccgagcccgcctcccctacaccgacgcagttctgcatgaggcgcag
cggctgctggctctggtgcccatgggggtgccccgtgcccttgcgaggaccacctgcttc
cgaggggcaccgaggtcttccccctccttggctctgtcctgcatgatcctgagatctttg
atgagccagaagaattcaatccagatcgattcctggatgcagacggacggttccagaagc
aggaggcattcctgcccttctccttag

DBGET integrated database retrieval system