KEGG   Canis familiaris (dog): 484566
Entry
484566            CDS       T01007                                 

Gene name
CLIP3
Definition
(RefSeq) CAP-Gly domain-containing linker protein 3
  KO
K10423  CAP-Gly domain-containing linker protein 3/4
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cfa04812]
    484566 (CLIP3)
Cytoskeleton proteins [BR:cfa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Cytoplasmic linker proteins (CLIPs)
     484566 (CLIP3)
SSDB
Motif
Pfam: CAP_GLY Ank_2 Ank_5 Ank_4 Ank
Other DBs
NCBI-GeneID: 484566
NCBI-ProteinID: XP_541680
Ensembl: ENSCAFG00000006665
VGNC: 39344
UniProt: F1PR86
Position
1
AA seq 547 aa
MTKTDPAPMAPPLRGEEEEEEEEDELVPEAPSPTQERRQKPVVHPSAPAPLPKDYAFTFF
DPNDPACQEILFDPQTTIPELFAIVRQWVPQVQHKIDVIGNEILRRGCHVNDRDGLTDMT
LLHYACKAGAHGVGDPAAAVRLSQQLLALGADVTLRSRWTNMNALHYAAYFDVPDLVRVL
LKGARPRVVNSTCSDFNHGSALHIAASNLCLGAAKCLLEHGANPALRNRKGQVPAEVVPD
PMDMSLDKAEAALVAKELRTLLEEAVPLSCALPKVTLPNYDNVPGNLMLSALGLRLGDRV
LLDGQKTGTLRFCGTTEFASGQWVGVELDEPEGKNDGSVGGVRYFICPPKQGLFASVSKI
SKVVDAPPSSVTSTPRTPRMDFSRVTGKGRREHKGKKKPPSSPSLGSLQQREGAKAEVGD
QVLVAGQKQGIVRFYGKTDFAPGYWYGIELDQPTGKHDGSVFGVRYFTCPPRHGVFAPAS
RIQRIGGSTDPPGDNVGAKKVHQVTMTQPKRTFTTVRTPKDIASENSISRLLFCCWFPWM
LRAEMQS
NT seq 1644 nt   +upstreamnt  +downstreamnt
atgactaagacagatcccgctccgatggcccctccactccggggggaggaagaagaagag
gaggaggaggatgagctggtccccgaggcccccagccccacccaggagcgccggcagaag
cctgttgtgcacccctcggcacctgcccccctccccaaggactacgccttcacattcttc
gatcccaatgacccggcgtgccaggagattctttttgacccccagaccaccatccctgaa
ctgttcgccattgtgcgccagtgggtgccccaagtccagcacaagatcgatgttattggc
aacgagattctgcgtcgaggctgccacgtgaatgatcgagatgggctgaccgacatgaca
ctgctccactacgcgtgcaaggctggggcccacggagttggggaccccgctgcggctgtg
cgcctttcgcagcagctgctggcgttgggcgccgacgtaacactgcgcagccgttggacc
aacatgaatgcgcttcactacgctgcctacttcgacgtgcccgacctcgtgcgagtgctg
cttaagggtgctcggccgagagtggtgaactccacgtgcagtgacttcaaccacggctca
gccctgcacatcgcagcctccaacctgtgcctgggtgccgccaaatgtttgctggagcat
ggtgccaaccctgcgctgcggaaccgaaagggtcaagtgccagcagaggtggtcccagac
cccatggacatgtccctggacaaggcagaggcagcactggtggccaaggagctgcgaaca
ctgctggaggaggccgtgccactctcctgtgccctccccaaggtcacactaccgaactat
gacaacgtcccaggcaatctgatgctcagtgcattgggcctgcgtctgggagaccgcgtg
ctgctggatggccagaagacgggcacacttcggttctgcgggaccacggagttcgccagt
ggccagtgggtgggcgtggagctggatgaacctgagggcaagaatgatggcagtgttggg
ggcgtccggtacttcatctgccctcccaagcagggtctctttgcctctgtgtccaagatc
tccaaggtagtggacgcacccccctcctctgtcacctccacacctcggactcctcggatg
gacttttcccgtgtcactggcaaaggccgcagggaacacaaaggcaagaagaagcccccg
tcctccccgtctctgggcagcctgcagcagcgggagggagccaaggctgaggtcggagac
caagtccttgttgccggccagaagcaagggattgtgcgcttctatgggaagacagacttt
gccccgggttactggtatggcattgagctagaccagccaactggcaagcatgatggctct
gtcttcggtgtccggtacttcacctgccccccacggcatggagtctttgcgccagcatcc
cgaattcagaggattggtggatccactgacccccctggggacaatgtcggagccaaaaaa
gtgcatcaagtgacaatgacacagcccaaacgcactttcacgacagtccggaccccaaag
gacatcgcatcagagaactccatctccaggttgctcttctgctgctggtttccctggatg
ctgagggcggagatgcagtcttag

DBGET integrated database retrieval system