KEGG   Canis familiaris (dog): 484670Help
Entry
484670            CDS       T01007                                 

Gene name
OXTR
Definition
(RefSeq) oxytocin receptor
  KO
K04229  oxytocin receptor
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04020  Calcium signaling pathway
cfa04024  cAMP signaling pathway
cfa04080  Neuroactive ligand-receptor interaction
cfa04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    484670 (OXTR)
   04024 cAMP signaling pathway
    484670 (OXTR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    484670 (OXTR)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    484670 (OXTR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cfa04030]
    484670 (OXTR)
G protein-coupled receptors [BR:cfa04030]
 Rhodopsin family
  Peptide
   Oxytocin
    484670 (OXTR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srsx Gaa1 7TM_GPCR_Srx DUF4191
Motif
Other DBs
NCBI-GeneID: 484670
NCBI-ProteinID: NP_001185588
Ensembl: ENSCAFG00000005553
VGNC: 44206
UniProt: E2RFT4
Position
20
AA seq 384 aa AA seqDB search
MERALAANWSAEAGNGSEAAPAAQGNRTAGPPQRNEALARVEVAVLCLILFLALSGNACV
LLALRTTRHKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQV
VGMFASTYLLLLMSLDRCLAICQPLRALRRRADRLAVLATWLGCLVASAPQVHIFSLREV
ADGVFDCWAVFIQPWGPKAYVTWITLSVYIVPVIVLAACYGLISFKIWQNLRLKTAAAAA
AEGREGAGRAALARVSSVKLISKAKIRTVKMTFIIVLAFIVCWTPFFFVQMWSVWDADAP
KEASAFIIAMLLASLNSCCNPWIYMLFTGHLFHELVQRFLCCSSSYLKGNRPGETSVSKK
SNSSTFVLSHHSSSQRSSSQPSTV
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcgcgctggcggccaactggagcgcggaggcgggcaacggcagcgaggcggcc
ccggcggcgcagggcaaccgcacggccgggcccccgcagcgcaacgaggccctggcgcgc
gtggaggtggccgtgctgtgcctcatcctcttcctggcgctgagcggcaacgcgtgcgtg
ctcctggcgctgcgcaccacgcgccacaagcactcgcgcctcttcttcttcatgaagcac
ctgagcatagccgacctggtggtggcggtgttccaggtgctgccgcagctgctgtgggac
atcaccttccgcttctacgggcccgacctgctgtgccgcctggtcaagtacctgcaggtg
gtgggcatgttcgcctccacctacctgctgctgctcatgtccctggaccgctgcctggcc
atctgccagccgctgagggcgctgcgccgccgcgcggaccgcctggccgtgctcgccacg
tggctgggctgcctggtggccagcgcgccgcaggtgcacatcttctcgctgcgcgaggtg
gccgacggcgtcttcgactgctgggccgtcttcatccagccctgggggcccaaggcctac
gtcacgtggatcacgctctccgtctacatcgtgcccgtcatcgtgctcgccgcctgctac
ggcctcatcagcttcaaaatttggcagaacctgcgactcaagacggcggcggcggcggcc
gcggaggggcgggagggcgcggggcgcgcggccctggctcgggtcagcagcgtcaagctc
atctccaaggccaagatccgcaccgtgaagatgaccttcataatcgtgctggccttcatc
gtgtgctggacgccgttcttcttcgtgcagatgtggagcgtctgggacgccgatgcgccc
aaggaagcctcggctttcatcatagccatgctcctggccagcctcaacagctgctgtaac
ccttggatctacatgctcttcacgggccacctcttccatgaacttgtacagcgcttcctc
tgctgctcctccagctacctgaaggggaaccgtccaggggagaccagcgtcagcaaaaag
agcaactcatccacctttgtcctgagccaccacagctccagccagaggagctcctcgcag
ccatccacagtgtga

DBGET integrated database retrieval system