KEGG   Canis familiaris (dog): 484961Help
Entry
484961            CDS       T01007                                 

Gene name
COL5A3
Definition
(RefSeq) collagen alpha-3(V) chain isoform X1
  KO
K19721  collagen, type V/XI/XXIV/XXVII, alpha
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    484961 (COL5A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cfa00536]
    484961 (COL5A3)
Glycosaminoglycan binding proteins [BR:cfa00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules
   484961 (COL5A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen COLFI Laminin_G_2 Laminin_G_3
Motif
Other DBs
NCBI-GeneID: 484961
NCBI-ProteinID: XP_013977681
Ensembl: ENSCAFG00000017958
VGNC: 39479
UniProt: F1P6C9
Position
20
AA seq 1749 aa AA seqDB search
MGSRRGLGQPRAGLCFVLASLQLLLRTQAEDPVDVLKALGVRGGQAGVLDGPGLCPQRAP
EGDRAFRVGKATILGIPTWELFPDGHFPENFSVLITLRGQPANQSVLLSIYDESGIRQLG
LALGPALGLLGDSFSPLPQQVNLMDGRWHRVAVSVDGRMVTLVADCEPQPPILGQGPRFI
SAAGLTVLGTQDLGEETFEGDVQELLISPDPQAAFQACERYLPGCDNLDPIATGVPQSEP
ETPPPRRKGKGKGKKKGRGRKGKGRKKKNKESLTPSPPPGSLENQTFTDIPNTETPASTL
PPTSTPLVITTTVTIGLNATMLEGGLDPDNGTELKTLKTKLAKEDQEGDGPTMGPDFRAA
EQPSQTQFQIFPGGGEKGAKGEPAVIEQGQKFEGPPGAPGPRGVVGPSGPPGPPGFPGDP
GLPGPAGLPGMPGIDGIRGLPGTVIMMPFQFASSSLKGPPVSFQQAQAQAVLQQAQLSMK
GPPGPVGLTGRPGPVGLPGYPGQKGEMGDIGPQGPRGLQGPLGPPGREGKMGRSGADGAR
GLPGDTGPKGDRGFDGLPGLPGEKGQRGDFGHVGQPGPPGEDGKKGAEGPPGPTGQAGEP
GPRGLIGPRGSPGPLGRPGVVGIDGAPGAKGNVGPPGEPGPPGQQGNPGSQGLPGPQGPI
GTPGEKGPPGNPGIPGVPGSDGPPGHPGHEGPTGEKGAQGPPGSAGPPGYPGPRGVKGTS
GNRGLQGEKGEQGEDGFPGFKGDGGPKGDRGHPGPPGPRGEDGPEGLKGQEGLAGEEGPP
GSAGEKGKLGVPGLPGYPGRPGPKGSTGFPGPLGPLGEKGKRGKAGQPGLEGERGPPGSR
GERGQPGATGQPGPKGDVGQDGAAGIPGEKGLPGLQGPPGFPGPKGPPGPQGKDGRPGHP
GQRGELGFQGQTGPPGPAGVVGPQGKTGEAGPLGERGPPGPPGPPGEQGLPGLEGREGIK
GDLGPPGPLGKEGPPGPRGFPGPQGAPGDPGPIGLKGDKGPLGPVGANGSPGERGPVGPA
GGIGLPGQSGGQGPVGPAGEKGSPGERGPPGPTGKDGIPGPLGLRGPPGAVGPSGEDGDK
GEVGAPGNKGSKGDKGDAGPPGPTGVRGPVGHPGSPGADGAQGRRGPPGLFGQKGDDGVR
GFAGVIGPPGLQGLPGPPGEKGEVGDVGSMGPHGAPGPRGPHGPSGPEGPPGLPGGVGQP
GAVGEKGEPGEAGDPGPPGTPGIPGPKGEIGEKGDSGPSGAAGPPGKKGPPGEDGAKGNV
GPTGLPGDLGPPGDPGVSGIDGSPGEKGDPGDVGGPGPPGASGEPGPPGPPGKRGPSGRV
GREGREGEKGAKGEPGPDGPPGMTGPVGARGPPGRMGPEGLRGIPGPVGEPGLLGPPGQM
GPPGPLGPSGLPGLKGDAGLKGEKGHIGLIGLIGPPGEAGEKGDQGLPGVQGPPGPKGEP
GPPGPIGSLGHPGPPGVAGPLGQKGSKGSPGSFGPRGDTGPPGPPGPPGPPAELHGLRRR
RRSLPGPGALEAPEGGMEEVLASLTSLSFELEQMRRPPGTAERPGLVCSELYRNHPHLPD
GEYWIDPNQGCARDALRVFCNFTAGGETCLYPDKKFETVKMASWSREKPGNWYSTFRRGK
KFSYVDADGSPVSVVQMTFLKLLSATAHQSFTYTCQNSAAWLDEAAGDHGRSVRFLGANG
EELSFNQTTAATITVPYDGCRLRKGQTKTLLEVSSSRVGFLPLWDVAAADFGQTNQKFGF
ELGPVCFSS
NT seq 5250 nt NT seq  +upstreamnt  +downstreamnt
atggggagtcgccgaggcctgggccagccgcgggccggcctctgcttcgtcctggcttcg
ctgcagcttctgctccggacgcaggccgaagaccctgtggatgtgctaaaggccctgggc
gtgcgagggggccaggctggggtccttgacgggcctggcctctgtccccagagggcccca
gagggtgaccgggcattcagggttggcaaggcgaccatacttggcatccccacatgggag
ctctttccagatgggcactttcctgagaacttttctgtgctgatcaccctgcggggccag
ccagccaaccagtctgtccttctatccatctatgacgagagtggtattcgacagctgggc
ctggctctggggccagccctgggtctcctaggtgactccttcagccccctcccccagcaa
gtcaacctcatggatggcaggtggcaccgtgtggcagtcagtgtggatggcaggatggtg
actctggtagctgactgtgaacctcagccccccatattgggccaggggccacgattcatt
agcgcagctggactcactgtgttggggacccaggaccttggggaggagacttttgaggga
gatgttcaggagttgctgataagcccagatcctcaggctgccttccaggcctgtgagagg
taccttcctggctgtgacaacctggatcctatagccacaggggtccctcaaagtgagcca
gaaactcctccccctcgacggaaggggaagggaaaaggaaagaaaaaagggcgaggccgc
aaggggaagggcaggaagaagaagaataaggaaagtttgacaccaagtccacctcctggg
tccctggagaaccagaccttcactgacatccctaatacagagacaccagcttcaactctg
cctccgacttctacacctttggtcatcaccaccactgtgaccattggcctcaatgccacc
atgctagaggggggcctggatcctgacaatggaactgaactaaagaccctgaagactaag
ttagccaaagaggaccaagaaggagatggccccaccatgggccccgacttccgggcagca
gaacagccatcacagacacagtttcaaatctttcctggtggtggagagaaaggagcaaaa
ggagagccggcagtgattgaacagggacagaagtttgagggacctccaggagccccagga
cctcgaggggtggttggcccctcaggccctcctggccccccaggattccctggagaccct
ggtctgccgggtcctgctggcctcccaggaatgcctggcatcgatgggatccggggtcta
ccagggactgtgatcatgatgccgttccagtttgcaagcagctccctcaaaggaccccca
gtctccttccagcaagcccaggctcaggcagtactgcaacaggctcagctgtctatgaaa
ggtccccctggtccagtagggctcactgggcgcccaggccctgtgggtctccctgggtat
ccgggtcagaaaggagagatgggagacatagggccacagggtccccgaggccttcaggga
cctcttgggcctcctggccgggagggaaagatgggccgctctggagcagatggggctcgg
ggccttccaggggacacaggacctaagggtgatcggggctttgatggcctaccagggctg
cctggtgagaagggccaaaggggtgactttggccatgtgggacaacctggccccccagga
gaggatggtaagaagggagcagaaggacctccggggcccactggccaagctggggagcca
ggcccccgaggactgatcggccctagaggctcccctggtcccctgggacgcccgggtgta
gttggaattgatggtgctccaggagccaaaggaaatgtgggtcctccaggagaaccaggc
cctccaggacagcagggaaatcctgggtcccagggactccctggccctcagggacctatt
ggcactcctggggagaagggtccccctggaaacccaggaattccaggcgtcccgggatct
gatggccctccgggtcacccaggccatgagggccccacaggagagaaaggggcacagggt
ccaccagggtcagcaggaccaccgggctatcctggacctcggggtgtgaagggtacctct
ggcaaccggggcctccagggggagaaaggagagcagggagaggatggctttcctggcttc
aagggcgatggggggcctaaaggagatcgggggcaccccggaccccccggaccccgggga
gaggatggtccagaagggctgaagggacaggaggggctggctggcgaggaggggccccca
ggctcagctggggagaagggcaagcttggggtgccaggtctcccgggttacccaggacgt
ccaggccctaagggctctactggctttcccgggcccctgggaccattaggagaaaaaggg
aaacgggggaaggcagggcagccaggcctggaaggagagcggggaccaccaggctcccgt
ggagagagggggcagccaggtgccaccgggcagccaggccccaagggcgatgtgggccag
gatggggccgctgggatccctggagaaaagggcctcccaggtctgcaaggccctcctgga
tttcctgggccaaagggtcctcctggcccccaggggaaagatgggcgtcctgggcaccct
ggccagagaggagaattgggcttccaaggccagacgggcccccctggaccagctggtgtc
gtgggtcctcagggaaagacaggagaagcaggacctctgggtgagagaggccccccgggc
cctcctggacctcctggtgaacaaggtcttccgggcctggaaggcagagagggcatcaag
ggggacctgggaccaccgggaccccttgggaaggaaggaccacctggacccaggggcttc
cccggcccccaaggagcccctggggacccagggcctattggtttaaagggtgacaaaggc
cccctgggccctgttggagccaatggctccccaggggagcggggtccagtgggcccagca
ggaggcatcgggcttcctggccaaagtggaggccaaggccctgttggccctgcaggcgag
aaggggtccccgggtgaacgtggcccccctggccccacagggaaagatgggatcccaggg
cccctggggcttcggggaccccctggagctgttgggccttctggcgaggatggggacaag
ggggaggtgggtgcccctggtaacaaagggagcaaaggcgataaaggggatgcgggccca
cctggaccaactggtgtacggggtcctgtgggacacccaggctccccgggagcagatggg
gctcaggggcgcaggggaccaccaggcctctttgggcagaaaggagatgatggagtgaga
ggctttgctggggtgattggcccccctggcctacaggggctgccaggccctcctggagag
aaaggggaggtcggagatgtagggtccatgggtccccatggagctccagggcctaggggt
ccccatggccccagtggaccagagggccctccagggctgcctgggggagttggtcagccg
ggtgctgtaggcgagaagggtgagccaggggaggctggagacccaggacccccaggaacc
ccaggcatccctgggcccaagggagaaattggtgaaaagggagactcaggcccatctggg
gctgctggacccccaggcaagaaaggtccccctggagaggatggagccaaagggaatgtg
ggccccactgggctcccaggagatctaggaccccctggagaccctggagtttcgggtatc
gatggctccccaggagagaagggagaccctggtgatgttgggggaccgggtccacctggg
gcttctggggaacctggcccccctgggcctcctggcaagaggggtccttcaggtcgtgtg
ggtcgagaaggcagagaaggggagaaaggagccaagggggagccaggtcctgacggaccc
ccagggatgacaggcccagtgggggctcgagggccccctggacgtatggggcctgagggt
cttcgagggatccccggccctgtgggtgaaccaggtctcctgggtcctcctggacagatg
ggccctcctggacccctggggccctctggccttccaggattgaagggagatgctggcctc
aagggggaaaagggccacattggattaattggcctcatcggtccccctggggaagctggt
gagaaaggggatcaggggttgccaggcgtgcagggcccccctggccccaagggagaacct
ggtccccctggtcccattggctctctgggccaccctgggcccccaggcgtggcgggtcct
ctagggcagaaaggctccaaggggtccccgggatcctttggtccccgtggtgacactggc
ccccctggcccccctggccctccgggtcccccagctgagctgcacgggctgcgcaggcgc
cggcgctctctcccaggcccaggggcgctcgaggccccggagggcggcatggaggaggtg
ttggcctcactcacatcgctgagctttgagctggagcagatgcggcgccctccgggcacc
gctgagcgcccaggcctcgtgtgcagtgagctgtaccgcaatcacccacacttgcctgat
ggggagtactggattgaccccaaccagggctgtgcgagggatgcgctcagggttttctgc
aacttcacggcaggaggagagacctgtctctacccggacaagaagtttgagacagtaaaa
atggcctcctggtccagggaaaagccaggaaactggtatagcacattccgacgaggaaag
aagttctcctatgtggacgccgatgggtccccggtgagtgtggtacagatgaccttcctg
aagttgctgagtgccacagcccaccagagcttcacctacacctgccagaactctgccgcc
tggctggacgaagctgcgggcgaccacggccgttctgtgcgcttccttggggccaacggg
gaggagctgtctttcaaccagacgacagcggccaccatcaccgtcccctacgatggctgc
cggctccggaagggacagacgaagaccctcttggaggtcagctcttcccgagtggggttt
ctgcctctgtgggacgtggcagctgctgactttggccagacgaaccagaagtttgggttt
gaactgggccctgtctgctttagcagctga

DBGET integrated database retrieval system