KEGG   Canis familiaris (dog): 484990Help
Entry
484990            CDS       T01007                                 

Gene name
INSR
Definition
(RefSeq) insulin receptor isoform X1
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04010  MAPK signaling pathway
cfa04014  Ras signaling pathway
cfa04015  Rap1 signaling pathway
cfa04022  cGMP-PKG signaling pathway
cfa04066  HIF-1 signaling pathway
cfa04068  FoxO signaling pathway
cfa04072  Phospholipase D signaling pathway
cfa04150  mTOR signaling pathway
cfa04151  PI3K-Akt signaling pathway
cfa04152  AMPK signaling pathway
cfa04211  Longevity regulating pathway
cfa04213  Longevity regulating pathway - multiple species
cfa04520  Adherens junction
cfa04910  Insulin signaling pathway
cfa04913  Ovarian steroidogenesis
cfa04923  Regulation of lipolysis in adipocytes
cfa04930  Type II diabetes mellitus
cfa04931  Insulin resistance
cfa04932  Non-alcoholic fatty liver disease (NAFLD)
cfa04960  Aldosterone-regulated sodium reabsorption
Module
cfa_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    484990 (INSR)
   04015 Rap1 signaling pathway
    484990 (INSR)
   04010 MAPK signaling pathway
    484990 (INSR)
   04066 HIF-1 signaling pathway
    484990 (INSR)
   04068 FoxO signaling pathway
    484990 (INSR)
   04072 Phospholipase D signaling pathway
    484990 (INSR)
   04022 cGMP - PKG signaling pathway
    484990 (INSR)
   04151 PI3K-Akt signaling pathway
    484990 (INSR)
   04152 AMPK signaling pathway
    484990 (INSR)
   04150 mTOR signaling pathway
    484990 (INSR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    484990 (INSR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    484990 (INSR)
   04923 Regulation of lipolysis in adipocyte
    484990 (INSR)
   04913 Ovarian Steroidogenesis
    484990 (INSR)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    484990 (INSR)
  09149 Aging
   04211 Longevity regulating pathway - mammal
    484990 (INSR)
   04213 Longevity regulating pathway - multiple species
    484990 (INSR)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    484990 (INSR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    484990 (INSR)
   04931 Insulin resistance
    484990 (INSR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfa01001]
    484990 (INSR)
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:cfa04090]
    484990 (INSR)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     484990 (INSR)
Protein kinases [BR:cfa01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   484990 (INSR)
CD molecules [BR:cfa04090]
 Proteins
  484990 (INSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like fn3 Kinase-like
Motif
Other DBs
NCBI-GeneID: 484990
NCBI-ProteinID: XP_005633279
Ensembl: ENSCAFG00000018170
VGNC: 42043
Position
20
AA seq 1406 aa AA seqDB search
MIKGFKIDGRAPSPRQGPSEWVSRLRLHTCEAGPATTSSNPSVACLLTCLAFCLFFLPVC
PGMDIRNNLTRLHELANCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYG
LESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYSLMNITRGSVRIEKNNELCYL
ATIDWSRILDSVEDNYIVLNKDDNEECGDICPGTAKGKTNCPATVINGQFVERCWTHSHC
QKVCPTICKSHGCTAEGLCCHSECLGNCSEPDDPTKCVACRNFYLDGRCVETCPPPYYHF
QDWRCVNFSFCQDLHNKCKNSRRQGCHQYVIHNNKCIPECPSGYTMNSSNLMCTPCLGPC
PKVCHILEGEKTIDSVTSAQELRGCTVVNGSLIINIRGGNNLAAELEANLGLIEEISGYL
KIRRSYALVSLSFFRKLRLIRGETLEIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFF
HYNPKLCLSEIHKMEEVSGTKGRQERNDIALKTNGDQASCENELLKFSYIRTSYDKILLK
WEPYWPPDFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVDIDPPLRSNDPKSQNH
PGWLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSS
SQIILKWKPPSDPNGNITHYLVFWERQAEDSELYELDYCLKGLKLPSRTWSPPFEAEGSQ
KHNQSEYEESAGECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFVPRKSSSSPGAEDT
RPSRKRRALSDAGNVTAAIPTVPGFPNTSTSTPTSPEEHKPFEKVVNKESLVISGLRHFT
GYRIELQACNQDSPEERCSVAAYVSARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKE
PNGLIVLYEVSYRRYGDEELHLCVSRRHFALERGCRLRGLPPGNYSVRVRATSLAGNGSW
TEATYFYVTDYLDVPSNIAKIIIGPLIFVFLFSVVIGSIYLFLRKRQPDGPLGPLYASSN
PEYLSASDVFPCSVYVPDEWEVPREKITLLRELGQGSFGMVYEGNARDIVKGEPETRVAV
KTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVFKGQPTLVVMELMAHGDLKSYLR
SLRPEAENNPGRPPPTKQEMIQMAAEIADGMVYLNAKKFVHRDLAARNCMVAHDYTVKIG
DFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQP
YQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVDLLKDDLHP
SFPEVSFFHSEENKAPESEELEMEFEDMESVPLDRASHSQREEAGGRDAGSSLGLKRSYE
EHIPYTHMNGGKKNGRILTLPRSNPS
NT seq 4221 nt NT seq  +upstreamnt  +downstreamnt
atgattaagggtttcaagatagatggaagagccccgagccccaggcagggcccttctgag
tgggtctcgcgactcaggttgcacacctgcgaagctggccctgccactacttcttctaac
ccatccgtggcatgtttgctcacctgtcttgctttctgcttgtttttccttccagtgtgt
cctggcatggatatccggaacaacctaacgaggctgcatgagctggccaactgctcggtc
attgaaggacatttgcagatactgttaatgttcaaaacgaggcccgaggatttccgagac
ctcagtttccccaaactcatcatgatcactgattacttgctgctcttccgggtctatggg
ctggagagcctgaaggacctgttccccaacctcacggtcatccgaggctcgcgcctcttc
ttcaactacgcgctggtcatcttcgagatggtccacctgaaggagcttggcctctacagc
ttgatgaacatcacccggggctccgtccgcatcgagaagaacaatgagctctgctacctg
gccaccatcgactggtcccgcatcctggattctgtggaggataattatattgtgctgaac
aaagacgacaacgaggagtgtggggacatctgtccaggcactgccaagggcaagaccaac
tgccctgccactgtcatcaatgggcagtttgtcgagcggtgttggacacacagccactgc
cagaaagtttgtccgaccatctgcaagtcgcatggctgcaccgccgagggcctctgctgc
cacagcgagtgtttaggcaactgctccgagcccgacgaccccaccaagtgcgtggcctgt
cgcaacttctacctggatggcaggtgcgtggagacctgcccacccccgtactaccacttc
caagactggcgctgcgtgaacttcagcttctgccaggacctgcacaacaaatgcaagaac
tcccggagacagggctgccaccagtacgtcatccacaataacaagtgcatccccgagtgc
ccctctggctacacgatgaattccagcaacctgatgtgcactccgtgcctgggcccctgt
cccaaggtctgccacattctggaaggcgagaagaccatcgactcagtgacgtctgcccag
gagcttcgaggctgcactgttgtcaacggaagtctaatcatcaacattcgagggggcaac
aacctggcggccgagctggaggccaacctcggactcattgaagagatttccgggtacctg
aaaatccggagatcctatgctcttgtgtctctttcctttttccggaagttgcggctgatt
cgaggggagaccttggagatcgggaactactctttctatgccttggacaaccagaaccta
aggcagctatgggactggagcaaacacaacctcaccatcactcaggggaaactcttcttc
cactataatcccaaactctgcttgtctgagatccacaagatggaggaagtctcaggaacc
aaggggcgccaggagaggaacgacattgccctgaagaccaacggggaccaggcgtcttgt
gaaaacgaactacttaaattttcttacattcggacgtcttatgacaagatcttgctgaaa
tgggagccctactggccccccgacttccgagacctcctggggttcatgctcttctacaaa
gaggccccttatcagaatgtgaccgagtttgatgggcaggacgcgtgtggctccaacagc
tggacggtggtggacattgacccacctctgcggtccaacgaccccaaatcgcagaaccac
ccggggtggctgatgcggggtctcaagccctggacccaatatgccatctttgtcaagacc
ttggtcaccttttctgatgaacgccgcacgtatggagccaagagtgacatcatctatgtg
cagacagatgccactaatccttccgtccccctggatccaatctcggtttcgaattcctcg
tcccagattattctgaagtggaagcctccctctgaccccaatggcaatatcacgcactac
ctggttttctgggagaggcaggccgaagacagtgagctctatgagttggattattgcctc
aaagggttgaagctgccctcccggacctggtctccgccgttcgaggccgagggctcccag
aagcacaaccagagtgaatacgaggagtctgccggcgaatgctgctcctgccccaaaacg
gactctcagatcctcaaggagctagaggagtcctcttttaggaagacgtttgaggattac
ctgcacaacgtggtgtttgtccccagaaaatcctcttcgagccctggtgctgaggacact
aggccatcgaggaaacgcagggcgctcagtgatgctggcaacgtgacagcagctataccc
acagttcccggtttccccaacacctcgaccagcacgcccacgagcccggaggagcacaag
cccttcgagaaagtggtgaacaaagaatctctggtcatctccggtctgcgccacttcact
ggctaccgcatcgagctgcaggcttgcaaccaagactcccccgaggagaggtgcagcgtg
gcggcctatgtcagcgccaggaccatgcccgaagccaaggcagacgacatcgttggcccc
gtgacccacgaaatcttcgagaacaatgtcgttcacttgatgtggcaggagccaaaggaa
cccaatggtctgatcgtgctttatgaagtgagttaccgacggtatggcgatgaggagctg
cacctgtgtgtctcccggaggcattttgctctggagcgtggctgcaggctacgcgggctg
cctccggggaattacagcgtgcgagtccgggccacctccctggcgggtaatggctcctgg
acagaagccacctatttctacgtgacagactatttagatgtcccatcgaatattgcaaaa
attatcatcggccccctcatctttgtctttctcttcagtgttgtgattggaagtatttac
ctgttcctgagaaagaggcagccggatgggccactgggaccgctgtatgcttcttcaaac
cctgagtacctcagtgccagtgatgtgtttccatgttctgtgtatgtgccggacgagtgg
gaggtgccgcgggagaagatcaccctcctgcgcgagctggggcaaggctccttcggcatg
gtgtacgagggcaacgccagggacatcgtcaagggtgagcccgagacccgcgtggccgtc
aagaccgtcaacgagtccgccagcctgcgagagaggatcgagtttctcaatgaggcatca
gtcatgaagggcttcacctgtcaccacgtggtccgcctcctgggggtggtgttcaaaggc
caaccgacgctggtggtgatggagctgatggctcatggagacctgaagagctacctccgc
tccctgcggccggaggctgagaataaccccggccgccctccgcctaccaagcaagagatg
attcagatggcggcggagatcgccgacgggatggtctacctgaacgccaagaagtttgtg
caccgggatctagcagcccgaaactgcatggttgcccacgattacactgtcaaaattgga
gactttgggatgaccagagacatctatgagacggattactatcggaaaggaggcaagggt
ctgctccccgtgcggtggatggcaccggagtccctgaaggacggggtctttaccacttct
tctgacatgtggtcctttggcgtggtcctttgggaaatcaccagcttggcagagcagcct
taccaaggcctgtctaatgaacaggtgttgaaatttgtcatggacggagggtatctggat
caacccgacaattgtccagagagagtcactgacctgatgcgcatgtgctggcagttcaat
cccaagatgcggcccaccttcctggagattgtcgacctgctcaaggatgatctgcacccc
agctttccagaagtttccttcttccacagcgaggagaacaaggcacccgagagcgaggag
ttggagatggagtttgaggacatggagagtgtccctctggatcgggcctcacactctcag
agggaggaggccgggggccgggatgcagggtcctcgctgggcctaaagcggagctacgag
gagcacatcccctacactcacatgaacgggggcaagaaaaatggacggattctgactctg
ccaaggtcgaatccttcctaa

DBGET integrated database retrieval system