KEGG   Canis familiaris (dog): 485067
Entry
485067            CDS       T01007                                 

Gene name
SGTA
Definition
(RefSeq) small glutamine-rich tetratricopeptide repeat-containing protein alpha
  KO
K16365  small glutamine-rich tetratricopeptide repeat-containing protein alpha
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfa04147]
    485067 (SGTA)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   485067 (SGTA)
SSDB
Motif
Pfam: TPR_1 SGTA_dimer TPR_8 TPR_2 TPR_11 TPR_7 TPR_17 TPR_10 TPR_14 TPR_16 TPR_12 TPR_19 TPR_9 TOM20_plant NARP1 TPR_6 DUF627 BTAD Fis1_TPR_C STI1
Other DBs
NCBI-GeneID: 485067
NCBI-ProteinID: NP_001301054
Ensembl: ENSCAFG00000019382
VGNC: 46107
UniProt: F6XMP7
Position
20
AA seq 313 aa
MDNKKRLAYAIIRFLHDQLRHGGLSSDAQESLEVAIQCLETAFGVTVEDHDLALPQTLPE
IFEAAAAGKEVPQDLRSPERTPPSEEDSAEAERLKTEGNEQMKVENFEAAVHFYGKAIEL
NPANAVYFCNRAAAYSKLGNYTGAVQDCERAICIDPSYSKAYGRMGLALSSLNKHTEAVA
YYKKALELDPENETYKSNLKIAELKLRETPSPTGGVGSFDIAGLLNNPSFMSMASNLMNN
PQVQQLMSGMISGGHNPLGTPGTSPSQNDLASLIQAGQQFAQQMQQQNPELIEQLRSQIR
SRTPSASNDDQQE
NT seq 942 nt   +upstreamnt  +downstreamnt
atggataacaagaagcgtctggcctacgccatcatccggttcctgcacgaccagctccgg
cacggggggctctcgtccgacgcccaggagagcttggaagttgcaatccagtgcctggag
actgcttttggggtgaccgtggaagaccatgacctcgccctccctcagactctgccggaa
atatttgaagcagctgctgcaggcaaggaggtgccgcaggacctgaggagccccgagcgg
accccgccttcagaggaggactcagccgaggcagagcgcctcaaaaccgaaggaaacgag
cagatgaaggtagaaaactttgaagctgccgtgcacttctatgggaaagccatcgagctg
aacccggccaacgccgtctacttctgtaacagagctgcggcctacagcaagctcgggaac
tacacgggtgccgttcaggactgcgagcgagccatctgcatagacccgtcctacagcaaa
gcctacggcaggatgggcctcgctctctccagtttgaacaagcacaccgaggccgtggca
tactacaagaaggctttggagctggatcctgagaacgagacttacaagtcaaacctcaag
atagccgagctgaagctgagagagacgccgagtcccacgggaggcgtcggcagctttgac
atcgccggcctgctcaacaaccccagcttcatgagcatggcgtcaaacctaatgaacaat
ccgcaggttcagcagctcatgtccgggatgatttcgggcggccacaaccccctggggact
cccggcaccagcccctcacagaacgacctggccagtctcatccaggctggccagcagttc
gcccagcagatgcagcagcagaacccagagttgatagaacagctccggagtcagatccga
agtcggacccccagtgccagcaacgacgaccagcaggaatga

DBGET integrated database retrieval system