KEGG   Canis lupus familiaris (dog): 485348
Entry
485348            CDS       T01007                                 

Definition
(RefSeq) olfactory receptor 226
  KO
K04257  olfactory receptor
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    485348
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cfa04030]
    485348
G protein-coupled receptors [BR:cfa04030]
 Others
  Chemoreception
   Olfactory
    485348
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srv Ilm1
Other DBs
NCBI-GeneID: 485348
NCBI-ProteinID: XP_022263701
Ensembl: ENSCAFG00000006654
Position
21
AA seq 327 aa
MEQSNQSGRVSEFVLLGFPAPAPLRALLFALSLLAYVLVLTENTLIIVAIRSHPTLHKPM
YFFLANMSFLEIWYVTVTIPKMLAGFVGSKQSHGQLISFEGCMTQLYFFLGLGCTECVLL
AVMAYDRYVAICHPLHYGVIVSGRLCVQLATGSWTGGFGISMVKVFLISRLSYCGPNIIN
HFFCDVSPLLNLSCTDMSTAELTDFVLAIFILLGPLSVTGASYMAITGAVVRIPSAAGRH
KAFSTCASHLTVVIIFYAASIFIYARPKALSAFDTNKLVSVLYAVIVPLLNPIIYCLRNQ
EVKRALRRTLHLYQGQDTKHRKASRGG
NT seq 984 nt   +upstreamnt  +downstreamnt
atggagcagagcaaccagagtggaagggtaagtgagtttgtgttgctgggcttcccagct
cctgcaccactgcgggcacttttatttgccctttctctgctagcctatgtgttggtgctg
actgaaaatacactcatcattgtggcaattaggagccatcccacccttcacaaacccatg
tacttttttctggcgaatatgtccttcttggagatatggtatgttactgtcactattccg
aagatgttagctggctttgttgggtcaaaacagagccatggacagctaatctcctttgag
ggctgcatgacacagctctactttttcctgggactgggctgcactgagtgtgtccttctt
gctgttatggcctatgatcgttatgtggccatctgtcatcctctccactatggtgtcatt
gtcagtggccggctgtgtgtgcagctagcaactggctcctggactggaggctttggcatc
tccatggtcaaagtttttctcatttctcgcctctcctactgtggacccaacatcatcaac
cactttttctgtgatgtctccccattgctcaatctttcatgcactgacatgtcaacagca
gagcttacagactttgttctggccatttttatcctgctggggccactctctgtcactggg
gcctcctacatggccatcactggtgctgtagtgcgcattccttcagctgctgggcgccat
aaagccttttccacctgtgcctctcaccttactgttgtgatcatcttctatgcagccagt
atcttcatctacgcccggccaaaggcactctcagcttttgacaccaacaagctagtttct
gtactctatgctgtcattgtaccattgcttaaccctatcatttactgcttgcgcaatcaa
gaggtgaagagagccctacgccgcactctgcacctctaccagggccaggatactaagcac
aggaaagctagtagaggtggatag

DBGET integrated database retrieval system