KEGG   Canis familiaris (dog): 485424Help
Entry
485424            CDS       T01007                                 

Gene name
LIN7C
Definition
(RefSeq) protein lin-7 homolog C
  KO
K19931  protein lin-7
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfa04131]
    485424 (LIN7C)
Membrane trafficking [BR:cfa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    485424 (LIN7C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: L27 PDZ PDZ_6 PDZ_2 Complex1_LYR_2 His_Phos_2
Motif
Other DBs
NCBI-GeneID: 485424
NCBI-ProteinID: XP_542543
Ensembl: ENSCAFG00000010196
UniProt: E2RJN7
Position
21
AA seq 197 aa AA seqDB search
MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAVREVYEHVYET
VDISSSPEVRANATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYIS
RIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGKVKLVVRYTPKVLEE
MESRFEKMRSAKRRQQT
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctgggggagcccgtgcggctggagcgggatatttgtagagcaatagagttg
ttggaaaaactgcaaagaagtggagaggtgccaccacagaaactgcaggccttacaaaga
gtccttcaaagtgaattctgcaatgctgtgagagaggtatatgaacacgtctatgagact
gtggacatcagtagcagtcccgaagtgagagctaatgcaactgcaaaggctactgtggct
gcgtttgctgccagcgaaggacattctcatcctcgagttgttgagctaccaaaaacagaa
gaaggccttggattcaatattatgggaggcaaagaacaaaactctccaatctatatatct
cgaataattccgggtggaattgctgatagacatgggggcctcaagcgaggagatcaactc
ctttctgttaacggagtgagcgttgaaggagaacatcatgaaaaagctgtagaactgctg
aaagcagctcagggaaaggttaaattagtagtacgatatacacccaaggtcctagaagaa
atggagtcacgctttgaaaaaatgagatcagcaaaacgcaggcaacagacctaa

DBGET integrated database retrieval system