KEGG   Canis familiaris (dog): 485469Help
Entry
485469            CDS       T01007                                 

Definition
(RefSeq) protocadherin-8 isoform X1
  KO
K16499  protocadherin delta 2
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:cfa04515]
    485469
Cell adhesion molecules [BR:cfa04515]
 Cadherins
  Protocadherins
   485469
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin Cadherin_2
Motif
Other DBs
NCBI-GeneID: 485469
NCBI-ProteinID: XP_542588
Ensembl: ENSCAFG00000004836
UniProt: E2RM28
Position
22
AA seq 1072 aa AA seqDB search
MGPAGRGGSPCLLPLQLFSLCWVLSVAQSKTVRYSTFEEDAPGTVIGTLAEDLHMKVSGD
ASFRLMKQFNSSLLRVREGDGQLTVGDAGLDRERLCGQAPQCVLAFDVVSFSQEQFRLVH
VEVEVRDINDHAPRFPRAQIPVEVSEGAAVGTRIPLEVPVDEDVGANGLQSVRLAEPHSP
FRVELQTRADGAQCADLVLLQELDRESQAAYSLELVAQDGGRPPRSATAALSVRVLDAND
HSPAFPQGAVAEVELAEDAPVGSLLLDLDAADPDEGPNGDVVFAFGARTPPEARRLFRLD
PRSGRLTLAGPVDYERQDTYELDVRAQDRGPGPRASTCKVIVRIRDVNDNAPDITITPLA
APGAPAASPFAAAAAAAAAALGGADATSPTGPGTPEAGAVSLVPEGAARESLVALVSTSD
RDSGANGQVRCALYGHEHFRLQPAYAGSYLVVTAASLDRERIAEYNLTLVAEDRGAPPLR
TVRPYTVRVSDENDNAPLFTRPVYEVSVRENNPPGAYLATVAARDPDLGRNGQVTYRLLE
AEVGRAGGSVSTYVSVDPATGAIYALRSFDYETLRQLDVRIQASDGGSPQLSSSALVQVR
VLDQNDHAPVLVHPAPANGTLEVAVPGRTARDTAVARVQARDADDGANGELAFELLQQEP
REAFAIGRRTGEIVLTGDLSQEPPGRAFRALLVVSDGGRPPLSTTATVSFVVTAGGGRGP
GAPASAGGPERSRPPGSRLAASGPALQWDTPLIVIIVLAGSCTLLLAAIIAIATTCNRRK
KEVRKGGARREERPGAAGGGASAPGSPEEAARGAGPRPNMFDVLTFPGSGKAPFGSPAAD
PPPPAVAAAEVPGSEGGSATGESSCHFEGQQRLRGAHAEPYGASPGFGKEPAPPVAVWKG
HSFNTISGREAEKFSGKDSGKGDSDFNDSDSDISGDALKKDLINHMQSGLWACTAECKIL
GHSDRCWSPSCGGPNTHPPPHPPAQMSTFCKSTSLPRDPLRRDNYYQAQLPKTVGLQSVY
EKVLHRDYDRTVTLLSPPRPGRLPDLQEIGVPLYQSPPGRYLSPKKEANENV
NT seq 3219 nt NT seq  +upstreamnt  +downstreamnt
atgggtccagcggggcgcgggggcagcccctgccttctccctttacagctcttcagcctc
tgctgggtgctctcggtggcccagagcaagacagtgcgatacagcaccttcgaggaggac
gcccccggcacggtcatcgggaccctggccgaggacctgcatatgaaagtgtccggagac
gccagcttccgcctgatgaagcagttcaacagctcgctgctccgggtgcgcgagggcgac
gggcagctgaccgtcggggacgcgggcctggaccgcgagcggctgtgcggccaagcgcca
cagtgcgtgctggccttcgacgtggtcagcttctcccaggagcagttccggctggtgcac
gtggaggtggaggtgagggacatcaacgaccacgcgccgcgcttcccccgggcccagatc
cccgtggaggtgtcggagggcgcggccgtgggcacgcgcatccccctggaggtgccggtg
gacgaggacgtgggggccaacggactgcagagcgtgcgcctggccgagcctcacagcccc
ttccgcgtggaactgcagacgcgcgcggacggcgcccagtgcgcggacctggtgctgctg
caggagctggaccgcgagagccaggccgcctacagcctggagctggtggcccaggacggc
ggccgcccgccgcgctccgccacggccgccctcagcgtgcgggtgctggacgccaacgac
cacagcccggccttcccgcagggcgccgtggccgaagtggagctggcggaggacgcgccc
gtgggctcgctgctgctcgacctggacgcggcggaccccgacgagggccccaacggcgac
gtggtgttcgccttcggggcccgcaccccgcccgaggcgcgccgcctcttccgcctggac
ccgcgctccggccgcctcaccctggcgggacccgtggactacgagcgccaggacacctac
gagctggacgtgcgcgcccaggaccgcggccccgggccccgggcctccacctgcaaggtc
atcgtgcgcatccgcgacgtcaacgacaacgctccggacatcaccatcaccccgctggcc
gccccgggcgcacctgccgcctctcccttcgccgcggccgccgccgccgccgccgccgct
ctcgggggtgcggacgcgacctcgcccaccgggcccgggacgccggaggcgggcgccgtc
tccctggtgccagagggggcggcgcgcgagagcctggtggcgctggtcagcacctcggac
agggactcgggcgccaacgggcaggtgcgctgcgccctctacgggcacgagcacttccgg
ctgcagccggcctacgcgggcagctacctggtggtgaccgcggcgtcgctggaccgcgag
cgcatcgccgagtacaacctgacgctggtggccgaggaccgcggcgcgcccccgctacgc
accgtgcggccctacaccgtgcgcgtgagcgacgagaacgacaacgcgccgctcttcacg
cggccagtctacgaggtgtcggtgcgtgagaacaatccgcccggcgcctacctggccacg
gtggccgcgcgggacccggacctgggccgcaacggccaggtcacctaccggctgctggag
gcagaagtgggccgcgccgggggctcggtgtccacctacgtgtcggtggacccggccacc
ggggccatctacgcgctgcgcagcttcgactatgagacgctgcgccagctcgacgtgcgc
atccaggcgagcgacggaggctccccgcagctctccagcagcgccctggtgcaggtgcgg
gtgctggaccagaacgaccacgcaccggtcctggtgcacccggcgccggccaacgggacc
ctggaagtggcggtccccgggcgcacggcgagggacacggccgtggcgcgcgtgcaggct
cgggacgcggacgacggtgccaacggggagctggcgttcgagctgctgcagcaggagccg
cgagaagccttcgccatcggccgccgcacgggggagatcgtgctcacaggcgacctctcg
caggagccgccgggccgcgcgttccgggcgctgctggtcgtgtccgacggcggccgcccc
ccgctctccaccaccgccaccgtcagcttcgtggtgaccgcgggcggcgggcgcgggccg
ggggcgcccgccagcgcggggggcccggagcgatctcgcccgcctggctcgcggctcgcg
gcgtcggggccggcgctgcagtgggacacgccgctgatcgtcatcatcgtgctggccggg
agctgtacgctgctgctggccgccatcatcgccatcgccaccacctgcaaccgccgcaag
aaggaggtgcgcaaagggggggcccgccgggaagagcggcccggggcggcgggcggcgga
gcctcggctcccggctccccggaggaggctgcccggggagccgggcccaggcccaacatg
ttcgacgtgctcaccttccctggcagcggcaaagcgccctttggcagccccgcggccgac
ccgcccccgcccgcggtcgccgcggccgaagtgccgggctcggagggcggcagcgccacc
ggggaaagctcctgtcacttcgaggggcagcagcggctccgcggcgcgcacgccgagccc
tacggcgcctcgcccggcttcggaaaggagccggcgccccctgtggcggtctggaaagga
cactccttcaacaccatctcgggccgggaagcggagaagttcagcggcaaagacagcggt
aaaggggacagcgacttcaacgacagcgattccgacatcagcggggacgctctgaaaaag
gatctcatcaaccacatgcagagcggactgtgggcgtgtaccgcggagtgtaagatcctg
ggccactctgaccgctgctggagcccgtcatgcggagggcccaacacgcatcccccacct
cacccgccagcccagatgtctaccttctgtaagagcacgtccctgcctcgggatcctctg
cgcagggacaattactaccaggcccagctgcccaagacggtggggctgcagagcgtctat
gagaaagtgctgcatagggactacgacaggacagtcactctgctctcccctccccgtccg
gggaggctcccagacttgcaggagatcggggtacccctctatcagtccccccctggcagg
tacctgtccccaaagaaggaagccaatgaaaatgtgtaa

DBGET integrated database retrieval system