KEGG   Canis familiaris (dog): 485504Help
Entry
485504            CDS       T01007                                 

Gene name
SPRY2
Definition
(RefSeq) protein sprouty homolog 2
  KO
K17383  protein sprouty homolog 2
Organism
cfa  Canis familiaris (dog)
Pathway
cfa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    485504 (SPRY2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sprouty
Motif
Other DBs
NCBI-GeneID: 485504
NCBI-ProteinID: XP_003433107
Ensembl: ENSCAFG00000005260
VGNC: 46766
UniProt: E2RGU9
Position
22
AA seq 315 aa AA seqDB search
MEARAQSGSGSQSLLQAPRDVGRQRGEPDPRDALTQQVHVLSLDQIRAIRNTNEYTEGPT
VVPRPGLKPAPRPSTQHKHERLHGLPEHRQPPRFQHPQAHSSARVPLSRSISTVSSGSRS
STRTSTSSSSSEQRLLGPSFSSGPVADGIIRVQPKSELKPGELKPLSKEDLGLHAYRCED
CGKCKCKECTYPRPLPSDWICDKQCLCSAQNVIDYGTCVCCVKGLFYHCSNDDEDNCADN
PCSCSQSHCCTRWSAMGVMSLFLPCLWCYLPAKGCLKLCQGCYDRVNRPGCRCKNSNTVC
CKVPTVPPRNFEKPT
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggaggccagagctcagagcggcagcgggtcgcagtccttgctgcaggcaccccgtgac
gttggcaggcagcgtggggagcctgaccccagggatgccctcacccagcaggtacacgtg
ttgtctctggatcagatcagagccatccgaaacaccaatgagtacacggaggggcctact
gtggtcccgagacctgggctcaagcctgctcctcgcccctccactcagcacaaacacgag
aggctccacggtctgcccgagcaccgccagcctcccaggttccagcacccacaggcccat
tcttctgcacgagtccctctgtccaggtccatcagcacagtcagctccggctctcggagc
agtacaaggacaagtaccagcagcagttcctctgaacagagactcttaggaccatctttc
tcctcggggcctgttgctgatgggataatccgtgtgcagcccaaatcggagctcaagcca
ggtgagcttaagccactgagcaaggaagatttgggcctgcatgcctacaggtgtgaggac
tgtggcaagtgcaagtgtaaagagtgcacctaccctaggcctctgccatcagactggatc
tgcgacaagcagtgcctttgctcagcccaaaacgtgattgactatgggacatgtgtgtgc
tgtgtgaaaggtctcttctatcactgttctaatgatgatgaggacaactgtgctgacaac
ccgtgttcttgcagccagtctcactgttgtacacgttggtctgccatgggcgtcatgtcc
ctttttttgccttgtttatggtgttaccttccagccaagggttgccttaagttgtgccag
gggtgttatgaccgggttaacaggcctggatgccgctgtaaaaactcaaacacagtttgc
tgcaaagttcccactgtcccacccaggaactttgaaaaaccaacatag

DBGET integrated database retrieval system