KEGG   Canis lupus familiaris (dog): 485643
Entry
485643            CDS       T01007                                 

Gene name
NR1D2
Definition
(RefSeq) nuclear receptor subfamily 1 group D member 2
  KO
K08531  nuclear receptor subfamily 1 group D member 2
Organism
cfa  Canis lupus familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cfa03000]
    485643 (NR1D2)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:cfa03310]
    485643 (NR1D2)
Transcription factors [BR:cfa03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    485643 (NR1D2)
Nuclear receptors [BR:cfa03310]
 1. Thyroid hormone like
  1D. Rev-Erb
   485643 (NR1D2)
SSDB
Motif
Pfam: zf-C4 Hormone_recep LpxD
Other DBs
NCBI-GeneID: 485643
NCBI-ProteinID: XP_542763
Ensembl: ENSCAFG00000005754
VGNC: 43941
UniProt: E2QXI5
Position
23
AA seq 576 aa
MEVNAGGVIAYISSSSSASSPASCHSEGSENSFQSSSSSVPSSPNSSNSDNNGNPKNGDL
SNIEGILKNDRIDCSMKTSKSSAPGMTKSHSGVTKFSGMVLLCKVCGDVASGFHYGVHAC
EGCKGFFRRSIQQNIQYKKCLKNENCSIMRMNRNRCQQCRFKKCLSVGMSRDAVRFGRIP
KREKQRMLIEMQSAMKTMMNSQFSGHLQNDTLEHHEQTALPAQEQLRPKPQLEQENIKSS
SPSSDFAKDEVIGMVTRAHKDTFMYNQEQRENSAETMQPQRERIPKSMEQYNLNHDHCGS
GLSSHFPCSESQQHLNGQYKGRNIMHYPNGHAICIANGHCMNFSNAYTQRVCDRVSIDGF
SQNENKNNYLCNTGGRMHLVCPMSKSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFAKRI
PGFRDLSQHDQVNLLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHSMGAGDLL
NSMFEFSEKLNALQLSDEEMSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLIMKN
HPNEASIFTKLLLKLPDLRSLNNMHSEELLAFKVHP
NT seq 1731 nt   +upstreamnt  +downstreamnt
atggaggtgaatgcggggggtgtgatcgcctatatcagttcttccagctcagcctctagc
cctgcctcttgtcacagtgaaggttctgagaacagtttccaatcctcctcctcctctgtt
ccatcttctccaaatagctctaattctgataacaatggtaatcccaaaaatggagatctc
tccaatattgaaggcatcctgaagaatgatcgaatagattgttctatgaaaacaagcaaa
tcgagtgcacctgggatgacaaagagtcatagtggagtgacaaaatttagtggcatggtt
ctactgtgtaaagtctgtggggatgtggcgtcaggattccactatggagttcatgcttgt
gaaggctgtaagggtttctttcggagaagcattcagcaaaacattcagtacaagaagtgc
ctgaagaatgaaaactgttctataatgaggatgaatagaaacagatgtcagcagtgtcgc
ttcaaaaagtgtctgtcagttggaatgtcgagagatgctgttcggtttggtcgtattcct
aagcgtgaaaaacagaggatgctaattgaaatgcagagtgcgatgaagaccatgatgaac
agccagttcagtggtcatttgcagaatgacacattagaacatcatgaacagacagcctta
ccagcccaggaacagctgcgacccaagccccagcttgaacaagaaaacatcaaaagctct
tctccctcttctgattttgcaaaggatgaagtgattggcatggtgaccagggcacacaag
gatacctttatgtataatcaagagcagcgagaaaactcagcagagaccatgcagcctcag
agagaacggattcccaagagcatggagcaatataatttaaatcacgatcactgtggcagt
gggcttagcagccattttccatgtagtgagagccagcagcacctcaatggacagtacaaa
gggaggaacataatgcattacccaaatgggcatgccatttgtattgcaaatggacattgt
atgaacttctccaatgcttatactcaacgagtatgtgatagagtttcgatagatggattt
tctcagaatgagaacaagaataattacctgtgcaacactggagggagaatgcatctggtt
tgtccaatgagtaagtctccatatgtggatcctcataaatctgggcatgaaatctgggaa
gaattttcaatgagcttcactccagcagtgaaagaagtggtggaatttgcaaagcgtatt
cctggattcagagatctctctcagcatgaccaagtcaaccttttgaaggctgggactttt
gaggttttgatggtacggtttgcatcattgtttgatgcaaaggagcgtacggtcaccttt
ttaagtggaaaaaaatatagtgtcgatgatttacactcaatgggagcaggggatctgcta
aactctatgtttgaatttagtgagaagctaaatgccctccaacttagtgatgaagagatg
agtttgtttacagctgttgtcctggtatctgcagatcgatctgggatagaaaacgtcaac
tctgtggaggctttgcaggaaaccctcatccgtgcactaaggaccttaataatgaaaaac
catccaaatgaggcctctatttttacaaaacttcttctaaagttgccagatcttcgatct
ttaaacaacatgcactctgaggagctcttggcctttaaagttcacccctaa

DBGET integrated database retrieval system