KEGG   Canis familiaris (dog): 485823Help
Entry
485823            CDS       T01007                                 

Gene name
REM1
Definition
(RefSeq) GTP-binding protein REM 1
  KO
K07847  Rad and Gem related GTP binding protein 1
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:cfa04031]
    485823 (REM1)
GTP-binding proteins [BR:cfa04031]
 Small (monomeric) G-proteins
  Ras Family
   Rad/Gem/Kir [OT]
    485823 (REM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc FeoB_N ABC_tran RsgA_GTPase AAA AAA_22 MMR_HSR1 Arf RuvB_N AAA_5 AAA_24 AAA_16 AAA_18 AAA_28 AAA_33 DUF4245 RNA_helicase
Motif
Other DBs
NCBI-GeneID: 485823
NCBI-ProteinID: XP_005634966
Ensembl: ENSCAFG00000006991
VGNC: 45472
UniProt: J9NWX9
Position
24
AA seq 298 aa AA seqDB search
MTLNTQQEAKTPLRRRASTPLPLSPRGYQPGLLCTAPTTKSQHPRLGQSASLNPPTRQPS
PAPNGWSSESSDSEGSWEALYRVVLLGDPGVGKTSLASLFAGKQERDLHEQLGEDVYERT
LTVDGEDTTLVVMDTWEPEKRDESWSQDSCLQVGSAYVIVYSIADRGSFESASELRIQLR
RTHQADHVPIILVGNKADLARCREVSVEEGRACAVVFDCKFIETSAALQHNVAELFEGVV
RQLRLRRRDSAAPEPSVPRRRASLGQRARRFLARLTARSARRRALKARSKSCHNLAVL
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgacactaaacacccagcaagaagcaaagactcccctgcgtaggcgagccagcactcca
ctgcccctgtccccccggggctaccagcctggcctcctgtgtacagcacctaccacaaaa
tcccagcatccccggctgggccagtcagcctccctcaatcctcccactcggcaaccttca
cctgcccccaatggttggtcctctgaatccagtgactctgaaggctcctgggaggccctc
taccgcgtggtactgcttggagatcccggcgtagggaagaccagcctggccagcctcttt
gcagggaagcaagagcgggacctccatgaacagctgggagaagatgtgtacgagaggacc
ctcacggtggatggagaggataccacactggtggtcatggacacctgggagcctgagaaa
cgggatgaaagctggagccaggattcgtgcctgcaggtgggcagcgcctatgtcattgtg
tactccatcgcggacagaggcagcttcgagagtgcctctgagctccgcattcagctgcgg
cgcacacatcaggcagaccacgtgcccatcatcctggtgggcaacaaggccgacctggca
cgctgccgggaagtttccgtggaagagggccgcgcctgcgcagtggtgttcgactgcaag
ttcatcgagacgtcggccgcgctgcagcacaacgtggcggagctcttcgagggcgtggtg
cgccaactgcgcctgcgccgccgggacagcgcggccccggagccctcggtgccccggcgg
cgggcgagcctcggccagcgggcccgccgcttcctggcccgcctgacggcccgcagcgcc
cgccgccgggcgctcaaggcccgctccaagtcctgccacaacctggccgtgctctga

DBGET integrated database retrieval system