KEGG   Canis familiaris (dog): 485963Help
Entry
485963            CDS       T01007                                 

Gene name
NTSR1
Definition
(RefSeq) neurotensin receptor type 1
  KO
K04211  neurotensin receptor 1
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04020  Calcium signaling pathway
cfa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    485963 (NTSR1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    485963 (NTSR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cfa04030]
    485963 (NTSR1)
G protein-coupled receptors [BR:cfa04030]
 Rhodopsin family
  Peptide
   Neurotensin
    485963 (NTSR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srv 7tm_4 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 485963
NCBI-ProteinID: XP_543088
Ensembl: ENSCAFG00000012720
VGNC: 44014
UniProt: E2RN63
Position
24
AA seq 421 aa AA seqDB search
MRLNGSAPGPRGAAPGAKPFPLPPSGLEAALLVPGLGLSNGSGNESERPRAAPSSDLDVN
TDIYSKVAVTAVYLALFVVGTVGNSVTAFTLGRKKSLQNLQSTVHYHLGSLALSDLLILL
LAMPVELYNFIWVHHPWAFGDAVCRGYYFLRDACTYATALNVASLSVERYLAICHPFRAK
TLMSRSRTKKFISVIWLTSGLLAVPMPFTMGQQNRSADGHHPGGLVCTPVVVTATIKVVI
QINTFMSFVFPMVVISILNTIIANKLTVMVRQAAEQGQVCTVGDQHSSFSMSIEPGRVQA
LRHGVRVLRAVVIAFVVCWLPYHVRRLMFCYISDKQWTPFLYDFYHYFYMLTNALFYVSS
AINPILYNLVSANFRQAFLSTLACLCPLWGRRGRRPAFARKTNSVSSNHTFSSNVTRETL
Y
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctcaacggctcggctcccgggccccggggcgctgctccgggcgccaagcccttc
ccgctgccgccctcggggctggaggcggcgctgctggtcccgggcctgggcctcagcaac
ggctccggcaacgagtcggagcggccgcgagcggcgcccagcagcgacctggacgtgaac
acggacatctactccaaggtggcggtgaccgccgtgtacctggcgctcttcgtggtgggc
acggtgggcaactcggtgacggcgttcacgctgggccgcaagaagtcgctgcagaacctg
cagagcaccgtgcactaccacctgggcagcctggcgctgtccgacctgctcatcctgctg
ctggccatgcccgtggagctctacaacttcatctgggtgcaccacccctgggccttcggg
gacgccgtgtgccgcggctactacttcctgcgcgacgcctgcacctacgccaccgccctc
aacgtggccagcctgagcgtcgagcgctacctggccatctgccaccccttcagggccaag
accctcatgtctcgcagccgcaccaagaagttcatcagcgtcatctggctcacctcgggc
ctgctggccgtgcccatgcccttcaccatgggccagcagaaccgcagcgccgacggccat
caccccggcggcctggtgtgcacgcccgtcgtggttaccgccaccatcaaggtggtcatc
cagattaataccttcatgtccttcgtgttccccatggtggtcatctccatcctgaacacc
atcatcgccaacaagctgaccgtcatggtccgccaggcagctgagcagggccaggtgtgc
acggttggggaccagcacagctcattcagcatgtccatcgagcctggcagggtccaagcc
ctgcggcacggcgtccgggtcttacgggctgtggtcatcgccttcgtggtctgctggctg
ccctaccacgtgcggcgcctcatgttctgctacatttccgataagcagtggaccccgttc
ctgtacgacttttaccactacttctacatgctgaccaacgcgctcttctacgtcagctcg
gccatcaaccccatcctgtacaacctggtctctgccaacttccgccaggccttcctgtcc
accctggcctgcctgtgtcctctgtgggggcgcagggggaggaggccggccttcgccagg
aagaccaacagcgtgtccagcaaccacaccttctccagcaacgtcacccgggagacactg
tattag

DBGET integrated database retrieval system