KEGG   Canis familiaris (dog): 486035Help
Entry
486035            CDS       T01007                                 

Gene name
CDK8
Definition
(RefSeq) cyclin-dependent kinase 8 isoform X2
  KO
K02208  cyclin-dependent kinase 8/11 [EC:2.7.11.22 2.7.11.23]
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfa01001]
    486035 (CDK8)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cfa03021]
    486035 (CDK8)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     486035 (CDK8)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     486035 (CDK8)
Protein kinases [BR:cfa01001]
 Serine/threonine kinases: CMGC group
  CDK family
   486035 (CDK8)
Transcription machinery [BR:cfa03021]
 Eukaryotic type
  RNA polymerase II system
   Mediator complex
    CDK-module
     486035 (CDK8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo
Motif
Other DBs
NCBI-GeneID: 486035
NCBI-ProteinID: XP_005635587
Ensembl: ENSCAFG00000006870
VGNC: 39061
Position
25
AA seq 463 aa AA seqDB search
MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGIS
MSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKP
VQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLF
NSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQED
IKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLMKDFRRNTYTNCSLIKYMEKH
KVKPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLT
EEEPDDKGDKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSD
YQRSNPHAAYPNPGPSTSQPQSSMGYSTTSQQPPQYSHQTHRY
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggactatgactttaaagtgaagctgagcagcgagcgggagcgggtcgaggacctgttt
gaatacgagggctgcaaagttggccgcggcacttacggtcacgtctacaaagccaagagg
aaagatgggaaagatgataaagactatgctttaaaacaaatagaaggaactgggatctct
atgtcggcatgtagagaaatagcattacttcgagagcttaagcatccaaatgtcatctct
cttcaaaaggtatttctgtctcatgctgataggaaagtatggcttctgtttgactacgct
gaacatgacctctggcatataatcaagtttcacagagcttctaaagcaaacaagaagcca
gttcagttacctcggggaatggtgaagtcactattatatcagatcctagatgggattcac
tacctgcatgctaactgggtgttgcacagggatttgaaacctgctaatattttagttatg
ggtgaaggtcctgagcgaggaagagtaaaaattgctgatatgggctttgcccgattattt
aattcacctttgaagcctttagcagatttggatccggtggttgtgacgttctggtaccga
gccccagagctactcctgggggcaagacactataccaaagctattgatatttgggctata
gggtgtatatttgcagaactactaacgtcagaaccaatatttcactgtcgacaagaggac
atcaaaactagtaatccttatcaccatgaccagctggacagaatattcaatgtaatggga
tttcctgcagataaagattgggaagatataaaaaagatgcctgaacattcaacattaatg
aaagatttcagaagaaatacgtataccaactgcagccttatcaagtatatggaaaaacat
aaagttaaaccagatagtaaagcattccacttgcttcagaagttacttactatggaccca
ataaagcgaattacctcagaacaggctatgcaggatccctatttcttagaagatccactt
cctacatcagacgtttttgccggttgtcaaatcccttacccaaaacgagaatttttaaca
gaagaagaacccgatgacaaaggagacaaaaaccagcagcagcagcagggcaataaccat
actaatggaaccggtcacccagggaatcaagacagcagtcatacacagggacccccattg
aaaaaagtgagagttgttcctcctaccactacctcaggtggactcatcatgacctcagac
tatcagcgttccaatccacatgctgcctatcccaaccctggaccaagcacatcacagcca
caaagcagcatgggatactcaactacctcccagcagcctccacagtactcacatcagaca
caccggtactga

DBGET integrated database retrieval system