KEGG   Canis familiaris (dog): 486045Help
Entry
486045            CDS       T01007                                 

Gene name
ZDHHC20
Definition
(RefSeq) probable palmitoyltransferase ZDHHC20 isoform X2
  KO
K20028  palmitoyltransferase ZDHHC2/15/20 [EC:2.3.1.225]
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfa04131]
    486045 (ZDHHC20)
Enzymes [BR:cfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     486045 (ZDHHC20)
Membrane trafficking [BR:cfa04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    486045 (ZDHHC20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC Spt4
Motif
Other DBs
NCBI-GeneID: 486045
NCBI-ProteinID: XP_005635607
Ensembl: ENSCAFG00000007179
VGNC: 48586
Position
25
AA seq 335 aa AA seqDB search
MAPWTFWRCCQRGVGWVPVLFITFVVVWSYYAYVVELCVFTLSGNGENGKAVVYLVAFHL
FFVMFVWSYWMTIFTSPASPSKEFYLSNSEKERYEKEFSQERQQEILRRAARDLPIYTTS
ASRTIRYCEKCQLIKPDRAHHCSACDMCILKMDHHCPWVNNCVGFSNYKFFLLFLLYSLL
YCLFVATTVLQYFIKFWTNELSDTRAKFHVLFLFFVSTMFFISVLSLFSYHCWLVGKNRT
TIVKIGDKSLVMKRNTGYFQYFQAWVMVAVFQLALWGWIQNKLLLQIKMNMPEDLNCRGR
KQKTWEMTVLAQINPFPSNRLVNQKTDYWTVNLSG
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgtggacgttctggcgctgctgccagcgcggcgtgggctgggtgccggtgctc
ttcatcaccttcgtggtcgtctggtcctactacgcgtacgtggtggagctgtgcgtgttt
actctctctggaaatggagaaaacggaaaggccgttgtttaccttgtggctttccatctg
ttctttgttatgtttgtatggtcctattggatgacaattttcacatctcccgcttccccc
tccaaagagttctacttgtccaattctgaaaaggaacgttatgaaaaggaatttagccaa
gaaagacaacaagaaattttgagaagagcagcaagggacttacctatctacaccacatca
gcttcaaggaccatcagatattgtgaaaaatgtcagttgattaaacctgaccgggcacat
cactgctcagcatgtgacatgtgtattcttaagatggatcatcactgtccttgggtgaat
aactgtgtgggattttctaattacaaattcttcctgctgtttttattatattccttgtta
tattgccttttcgtggctacaacagttttacagtactttataaaattctggacgaatgaa
ctctctgatactcgtgcgaagttccacgtacttttccttttctttgtgtccacaatgttc
ttcatcagcgtcctgtcacttttcagctaccactgctggctagtcgggaaaaacagaaca
acaatagtaaaaattggagacaagtctttggtgatgaaaagaaatactggctacttccaa
tattttcaagcttgggtgatggttgcagttttccaactcgccttgtggggatggatccag
aacaagcttctgttacaaatcaaaatgaatatgccagaagatctaaactgcagaggtaga
aagcagaaaacttgggaaatgacagtattggctcaaatcaaccctttcccatcaaaccgc
ttagtgaatcaaaaaaccgattattggacagtgaatctcagtggatag

DBGET integrated database retrieval system