KEGG   Canis familiaris (dog): 486112
Entry
486112            CDS       T01007                                 

Gene name
STC1
Definition
(RefSeq) stanniocalcin-1
Organism
cfa  Canis familiaris (dog)
SSDB
Motif
Pfam: Stanniocalcin DUF562
Other DBs
NCBI-GeneID: 486112
NCBI-ProteinID: XP_543238
Ensembl: ENSCAFG00000009104
VGNC: 46895
UniProt: E2RST6
Position
25
AA seq 247 aa
MLQNSAVLLVLVISASATHEAEQNDSVSPRKSRVAAQNSAEVVRCLNSALQVGCGAFACL
ENSTCDTDGMYDICKSFLYSAAKFDTQGKAFVKESLKCIANGVTSKVFLAIRRCSTFQRM
IAEVQEECYSKLNVCSVAKRNPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTIRD
SLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTSEPQKLKVLLRNLRGEAASPSHIK
RTSHESA
NT seq 744 nt   +upstreamnt  +downstreamnt
atgctccaaaactcagcagtgcttctggtgctggtgatcagtgcttctgcaacccatgag
gcggagcagaatgattctgtgagccccaggaaatcccgggtggcagctcagaactcagct
gaagtggttcgctgcctcaacagtgctctgcaggttggctgcggggcttttgcatgcctg
gagaactccacctgtgacacagatgggatgtacgacatctgtaaatccttcttgtacagc
gctgctaaatttgacactcagggaaaagcatttgtcaaagagagcttaaagtgcatcgcc
aatggggtcacctccaaggtcttccttgccattcggaggtgctccactttccagaggatg
attgctgaggtgcaagaggagtgctacagcaagctgaatgtgtgcagtgtcgccaagcgg
aaccccgaagccatcaccgaggtcgtccagctccccaatcacttctccaacagatactat
aacaggctcgttcgaagcctcctggaatgtgacgaagacacagtcagcaccatcagagac
agcctgatggagaaaattgggcccaacatggccagcctctttcacatcctgcagacggat
cactgtgcccaaacgcacccgcgagctgacttcaacaggaggcgcaccagcgagccacag
aagctgaaagtcctcctcaggaacctccgaggtgaggcggcctctccctcccacatcaaa
cgcacctcccacgagagtgcataa

DBGET integrated database retrieval system