KEGG   Canis familiaris (dog): 486148Help
Entry
486148            CDS       T01007                                 

Gene name
IRS1
Definition
(RefSeq) LOW QUALITY PROTEIN: insulin receptor substrate 1
  KO
K16172  insulin receptor substrate 1
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04022  cGMP-PKG signaling pathway
cfa04068  FoxO signaling pathway
cfa04140  Autophagy - animal
cfa04150  mTOR signaling pathway
cfa04151  PI3K-Akt signaling pathway
cfa04152  AMPK signaling pathway
cfa04211  Longevity regulating pathway
cfa04213  Longevity regulating pathway - multiple species
cfa04722  Neurotrophin signaling pathway
cfa04910  Insulin signaling pathway
cfa04920  Adipocytokine signaling pathway
cfa04923  Regulation of lipolysis in adipocytes
cfa04930  Type II diabetes mellitus
cfa04931  Insulin resistance
cfa04932  Non-alcoholic fatty liver disease (NAFLD)
cfa04960  Aldosterone-regulated sodium reabsorption
cfa05206  MicroRNAs in cancer
Module
cfa_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    486148 (IRS1)
   04022 cGMP - PKG signaling pathway
    486148 (IRS1)
   04151 PI3K-Akt signaling pathway
    486148 (IRS1)
   04152 AMPK signaling pathway
    486148 (IRS1)
   04150 mTOR signaling pathway
    486148 (IRS1)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    486148 (IRS1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    486148 (IRS1)
   04923 Regulation of lipolysis in adipocyte
    486148 (IRS1)
   04920 Adipocytokine signaling pathway
    486148 (IRS1)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    486148 (IRS1)
  Nervous system
   04722 Neurotrophin signaling pathway
    486148 (IRS1)
  Aging
   04211 Longevity regulating pathway - mammal
    486148 (IRS1)
   04213 Longevity regulating pathway - multiple species
    486148 (IRS1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    486148 (IRS1)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    486148 (IRS1)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    486148 (IRS1)
   04931 Insulin resistance
    486148 (IRS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRS PH PH_11
Motif
Other DBs
NCBI-GeneID: 486148
NCBI-ProteinID: XP_543274
Position
25
AA seq 1240 aa AA seqDB search
MASPPETDGFSDVRKVGYLRKPKSMHKRFFVLRAASEAGGPARLEYYENEKKWRHKSSAP
KRSIPLESCFNINKRADSKNKHLVALYTRDEHFAIAADSEAEQDSWYQALLQLHNRAKGH
HDGASAPGAGGGGGSCSGSSGLGEAGEDLSYGDVPPGPAFKEVWQVILKPKGLGQTKNLI
GIYRLCLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTGPGEFWMQV
DDSVVAQNMHETILEAMRAMSDEFRPRSKSQSSSNCSNPISVPLRRHHLNNPPPSQVGLT
RRSRTESITATSPASMVGGKQGSFRVRASSDGEGTMSRPASVDGSPVSPSTTRTHAHRHR
GSSRLHPPLNHSRSIPMPSSRCSPSATSPVSLSSSSTSGHGSTSDCLFPRRSSASVSGSP
SDGGFISSDEYGSSPCDFRSSFRSVTPDSLGHTPPARGEEELSNYICMGGKGSSTLTAPN
GHYILPRGGNGHRYIPGAGLGTSPALAADEAAAAADLDNRFRKRTHSAGTSPTISHQKTP
SQSSVASIEEYTEMMPAYPPGGGSGGRLPGYRHSAFVPTHSYPEEGLEMHPLDRRGGHHR
PDAAALHTDDGYMPMSPGVAPVPSSRKGSGDYMPMSPKSVSAPQQIINPIRRHPQRVDPN
GYMMMSPSGSCSPDIGGGPGSSSSGSAAPSGSSYGKLWTNGVGGHHPHALPHPKLPVESG
SGKLLSCTGDYMNMSPVGDSNTSSPSDGYYGPEDPQHKPVLSYYSLPRSFKHTQRPGELE
ESARHXHLRLSSSSGRLLYAATAEDSSSSTSSDSLGPGGYCGVRPDPGLPHIHHQVLQPH
LPRKVDTAAQTNSRLARPTRLSLGDPKASTLPRVREQQHPPPLLHPPEPKSPGEYVNIEF
GSDQPGYLSGPVAARSSPSVRCPPQLQPAPREEETGTEEYMNMDLGPGRRAAWQEGAGVQ
PGRVGPAPPGAASVCRPTRAVPSSRGDYMTMQVGCPGQGYVDTSPVAPISYADMRTGIVV
EEASLPGATAAAPSSASAASASPTAPPKAGELVARSSLLGGPQGPGGMSAFTRVNLSPNR
NQSAKVIRADPQGCRRRHSSETFSSTPSATRAGNAVPFGGGAALGGSGGGSSAEDMKRHS
SASFENVWLRPGELGGAPKEPAPHAGAAGGLENGLNYIDLDLVKDFKQCSQERPPQPQPP
PPPAPHQPLGSSESSSTSRSSEDLSAYASISFQKQPEDLQ
NT seq 3723 nt NT seq  +upstreamnt  +downstreamnt
atggcgagccctccggagaccgacggcttctcggacgtgcgcaaggtgggctacctgcgc
aaacccaagagcatgcacaagcgcttcttcgtgctgcgggcggccagcgaggcggggggc
ccggcgcgcctcgagtactacgagaacgagaagaagtggcggcacaagtcgagcgccccc
aaacgctcgatccccctcgagagctgcttcaacatcaacaagcgggcggactccaagaac
aagcacctggtggccctttacacccgggacgagcactttgccatcgcggcggacagcgag
gccgagcaggacagctggtaccaggccctcctgcagctgcacaaccgggccaagggccac
cacgacggcgcctcggcccccggggcgggaggcggcgggggcagctgcagcggcagctcg
ggcctcggggaggccggcgaggacttgagctacggggacgtgcccccgggacctgcgttc
aaggaggtctggcaggtgatcctgaaacccaagggcctggggcagacaaagaacctgatt
ggcatctaccgcctctgcctgaccagcaagaccatcagcttcgtgaagctgaactccgag
gcggcggccgtggtgctgcagctgatgaacatccgacgttgcggccactcggagaacttc
ttcttcatcgaagtgggccgttccgcagtgacgggacccggcgagttctggatgcaggtg
gatgactccgtggtggcccagaacatgcacgagaccatcctggaggccatgcgggccatg
agcgacgagttccgccctcggagtaagagccagtcctcctccaactgctccaaccccatc
agcgtccccctgcgccggcaccacctcaacaacccccctcccagccaggtggggctgacg
cgccgctcgcgcaccgagagcatcaccgccacctctccggccagcatggtgggcgggaag
cagggctccttccgtgtgcgcgcgtccagcgacggcgagggcaccatgtcccgcccggcc
tcggtggacggcagccccgtgagcccgagcaccaccaggacccacgcgcaccggcatcgc
ggcagctcccggctgcaccccccgctcaaccacagccgctccatccccatgccttcctct
cgctgctcgccttccgccaccagcccggtcagcctgtcgtccagcagcaccagtggccac
ggctccacctcggactgcctcttcccccggcgctctagtgcctctgtgtcgggttccccc
agcgacggtggtttcatctcctctgacgagtacggctcgagtccctgcgatttccgaagt
tccttccgcagtgtcaccccggattccctgggccacacccccccggcccgcggcgaggag
gagctgagcaactacatctgcatgggaggcaaagggtcctccaccctcaccgcccccaac
ggtcactacattttgcctcggggtggcaatggccaccgctacatcccgggggctggcttg
ggcaccagcccggccctggctgcggatgaagcggccgctgcggccgacctggataaccgg
ttccgaaagcggactcactccgcgggcacatcccctaccatttcccaccagaagaccccg
tcccagtcttctgtggcttccattgaggagtacacggagatgatgcctgcctacccgcca
ggaggtggcagtggaggccgactgcctggctaccggcactctgccttcgtgcccacccac
tcctaccccgaggagggtctggaaatgcaccctctggacaggcgtgggggccaccaccgg
ccggacgccgccgccctccacacggatgatggctacatgcccatgtccccgggagtggca
ccggtgcccagcagccggaagggcagtggggactatatgcccatgagccccaagagcgtg
tccgcgccgcagcagatcatcaaccccattagacgccatccccagagggtggaccccaat
ggctacatgatgatgtccccaagcggcagctgctctcctgacattggaggtgggcccggc
agcagcagcagcggcagcgccgccccttctgggagcagctatggcaagctgtggacaaac
ggggtagggggccaccaccctcacgccctgccgcaccccaaactccccgtggagagcggg
agtggcaagctcctgtcttgtaccggcgactacatgaacatgtcgccggtgggggactcc
aacaccagcagcccctccgacggctactacggcccagaggacccccagcacaagccagtt
ctctcctactactcattgccaaggtcctttaagcacacccagcgccctggggagctggag
gagagcgcccggcacnagcacctccgcctctcctccagctcgggtcgtcttctctacgcc
gcgacggcggaagattcctcctcctccaccagcagcgacagcctgggcccagggggatac
tgtggggtcaggccggatcccggcctcccgcatatccaccatcaggtcctgcagcctcac
ctgcctcggaaggtggacacggccgcgcagaccaacagccgcctggctcggcccacgagg
ctgtccctgggggaccccaaggccagcaccttacctcgggttcgagagcagcagcacccg
ccgcccctgctgcaccctccggagcccaagagccccggggaatatgtgaatattgagttc
gggagcgatcagccgggctacttatcggggccggtggctgcccgcagctcgccttctgtc
aggtgcccaccccagctccagccagctccccgcgaggaagagactggcaccgaggagtac
atgaacatggacctggggcctggccggagggcagcctggcaggagggtgctggggtccag
cccggcagggtgggccccgcgccccccggggccgctagcgtgtgcaggcccacccgggca
gtgcccagcagccggggcgactacatgaccatgcaggtgggctgtcccggccagggctac
gtggacacctcgccagtggcccccatcagctacgctgacatgcggacaggcattgtcgtg
gaggaggccagcctgccgggggccacagcggccgccccctcctcggcctcggcagcctcg
gcttcccccacggcgcctccaaaagcgggggagctggtggcccgctcctccctgctgggg
ggcccgcagggacccgggggcatgagcgccttcacccgggtgaacctcagccccaaccgc
aaccagagtgccaaagtgatccgcgccgacccgcaggggtgccggaggcggcatagctct
gagaccttctcctccacgcccagtgccacccgggcgggcaacgcagtgcccttcggcggg
ggggcggccctggggggcagcggtggcggcagcagcgcggaggatatgaaacgccacagt
tcggcttcctttgagaacgtgtggctgaggcctggggagctcgggggagcccccaaggag
ccggccccgcacgctggggccgccgggggtttggagaatgggcttaactacatagacctg
gatttggtcaaggacttcaaacagtgctctcaggagcgcccccctcaaccgcagccgccc
ccgcccccggcccctcatcagcctctgggcagcagtgagagcagttcaaccagccgctcc
agcgaggatctaagcgcctatgccagcatcagtttccagaagcagccagaggacctccag
tag

DBGET integrated database retrieval system