KEGG   Canis lupus familiaris (dog): 486170
Entry
486170            CDS       T01007                                 

Symbol
TRPM8
Name
(RefSeq) transient receptor potential cation channel subfamily M member 8
  KO
K04983  transient receptor potential cation channel subfamily M member 8
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    486170 (TRPM8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cfa04040]
    486170 (TRPM8)
Ion channels [BR:cfa04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   486170 (TRPM8)
SSDB
Motif
Pfam: LSDAT_euk LSDAT_prok Ion_trans
Other DBs
NCBI-GeneID: 486170
NCBI-ProteinID: NP_001104239
Ensembl: ENSCAFG00000011936
VGNC: 47879
UniProt: Q1A7N1
Position
25
AA seq 1104 aa
MSFEGARLSMRNRRNGTLDSTRTLYSSTSRSTDVSYSESDLVNFIQANFKKRECVFFTKD
SKATENVCKCGYAQSQHIEGTQINSNEKWNYKKHTKEFPTDAFGDIQFETLGKKGKYIRL
SCDTDAETLYELLTQHWHLKTPNLVISVTGGAKNFALKPRMRKIFSRLIYIAQSKGAWIL
TGGTHYGLMKYIGEVVRDNTISRNSEENIVAIGIAAWGMVSNRDTLLRNCDAEGYFSAQY
IMDDFKRDPLYILDNNHTHLLLVDNGCHGHPTVEAKLRNQLEKYISERTIQDSNYGGKIP
IVCFAQGGGRETLKAINTSIKSKIPCVVVEGSGQIADVIASLVEVEDVLTSSVVKEKLVR
FLPRTVSRLPEEETESWIKWLKEILESSHLLTVIKMEEAGDEIVSNAISYALYKAFSTNE
QDKDNWNGQLKLLLEWNQLDLANEEIFTNDRRWESADLQEVMFTALIKDRPKFVRLFLEN
GLNLRKFLTNDVLTELFSNHFSTLVYRNLQIAKNSYNDALLTFVWKLVANFRRGFRKEDR
SSRDDIDVELHDVSPITRHPLQALFIWAILQNKKELSKVIWEQTRGCTLAALGASKLLKT
LAKVKNDINAAGESEELANEYETRAVELFTECYSSDEDLAEQLLVYSCEAWGGSNCLELA
VEATDQHFIAQPGVQNFLSKQWYGEISRDTKNWKIILCLFIIPLVGCGFVSFRKKPIDKH
KKILWYYVAFFTSPFVVFAWNVVFYIAFLLLFAYVLLMDFHSVPHSPELVLYALVFVLFC
DEVRQWYMNGVNYFTDLWNVMDTLGLFYFIAGIVFRLHPSNKTSLYSGRVIFCLDYIIFT
LRLIHIFTVSRNLGPKIIMLQRMLIDVFFFLFLFAVWMVAFGVARQGILRQNEHRWRWIF
RSVIYEPYLAMFGQVPSDVDGTTYDFAHCTFTGNESKPLCVELDEHNLPRFPEWITIPLV
CIYMLSTNILLVNLLVAMFGYTVGTVQENNDQVWKFQRYFLVQEYCNRLNIPFPFVVFAY
FYMVVKKCFGCCCREKHAEPSACCFRNEDNETLAWEGVMKENYLVKINTKANDTSQEMRH
RFRQLDTKINDLKGLLKEIANKIK
NT seq 3315 nt   +upstreamnt  +downstreamnt
atgtccttcgagggggccaggctcagcatgaggaacagaaggaacggcacgctggacagc
acccggaccctgtactccagcacgtctcggagcaccgacgtgtcctacagcgaaagcgac
ttggtgaattttattcaagcaaattttaagaaacgagaatgtgtcttcttcaccaaagat
tccaaggccacggaaaatgtgtgcaagtgtggctatgcccagagccagcacatagaaggc
acccagatcaactcaaacgagaaatggaattacaagaaacacaccaaggaatttccgact
gacgcctttggggatattcagtttgagactctggggaagaaagggaagtatatccgcctg
tcctgtgacacggatgcggagaccctctatgagctgctgacccagcactggcacctgaaa
acgcccaacctggtcatatctgtcaccggcggcgccaagaacttcgccctgaagccgagg
atgcgcaagatcttcagccgcctcatctacatcgcgcagtccaaaggtgcttggattctc
actggaggaacccattatggcctgatgaagtacatcggggaggtggtgagagacaacacc
atcagcaggaattcagaggagaacattgtggccattggcatagcggcttggggcatggtc
tccaacagggacactctcctcaggaattgcgatgctgagggatatttttcagctcagtac
ataatggatgacttcaagagagaccctctgtatatcttggacaacaaccacacccatctg
ctgcttgtggacaacggctgccatggacatcctacagttgaagcaaaactccggaatcag
ctggagaagtacatctccgagcgcactattcaagattccaactatggtggcaagatcccc
attgtgtgttttgcccaaggaggtggcagagaaactttgaaagccatcaacacctccatc
aaaagcaaaatcccctgtgtggtggtggaaggctcagggcagattgcagacgtgatcgcg
agcctggtggaggtggaggacgtcctgacgtcatctgtggtcaaggagaagttggtgcgc
ttcttaccccgcacagtgtcccggctgcctgaggaggagaccgagagttggatcaaatgg
ctcaaagaaattctcgaaagttctcacctattaacagttattaaaatggaagaagctgga
gacgaaattgtgagcaatgctatttcttatgctttgtacaaagcctttagcaccaatgaa
caagataaggataactggaatgggcagctgaagcttctgctggaatggaaccagctggac
ctagccaatgaggagatattcaccaacgaccgccgatgggagtctgctgatctgcaagag
gtcatgtttacagctctcataaaggacagacccaagtttgtccgcctcttcctggagaat
gggttgaacctgcgcaagtttctcaccaatgacgtcctcactgaactcttctccaaccac
ttcagcacccttgtctaccggaacctgcagattgccaagaattcctataacgatgccctc
ctcacattcgtctggaaactggtggccaacttccggagaggcttccgaaaggaagacaga
agtagcagggatgacatagatgtagaacttcacgatgtgtctcctatcactcggcacccg
ctgcaagcactcttcatctgggccattcttcagaacaagaaggaactgtccaaggtcatt
tgggagcagaccaggggctgcacgttggcagccctgggagccagcaagcttctgaagact
ctggccaaggtgaagaatgacatcaatgctgcaggggagtccgaggagctggcaaatgag
tatgagacccgtgcagttgagctgttcacggagtgctacagcagcgacgaggacctggcc
gagcagctgctggtgtactcctgcgaagcctggggcgggagcaactgcttggagctggcg
gtggaggccacggaccagcacttcatcgcccagcccggggtccagaattttctttccaag
caatggtatggagagatttcccgagacaccaagaactggaagattatcctgtgtttgttt
attatacccttggtgggctgtggctttgtatcctttaggaagaagcccatcgacaagcac
aagaagatcctgtggtactacgtggcgttcttcacctccccctttgtggtcttcgcctgg
aacgtggtcttctacatcgccttcctcctgctctttgcctacgtgctgctcatggatttt
cactcagtgccacactcccccgagctggtcctctacgcactggtctttgtcctgttctgt
gatgaagtgagacagtggtacatgaatggggtgaattattttaccgacctgtggaatgtc
atggacacacttgggcttttttacttcatagcaggcattgtgtttcggctccacccttct
aataaaacctctttgtattccggacgagtcatcttttgcctggattacattatattcacc
ctaaggttgatccacattttcaccgtaagcagaaatttgggaccgaagattataatgttg
cagaggatgctgatcgacgtgtttttcttcctgtttctgtttgccgtgtggatggtggcc
ttcggcgtggccaggcaagggatcctcaggcaaaatgagcatcgctggaggtggatattc
cgctcggttatctacgagccctacctggccatgttcggccaagtgcccagcgacgtggat
ggtaccacatatgactttgcccactgcactttcactgggaatgagtccaagccgctgtgt
gtggagctggatgagcacaacctcccccggttccccgagtggatcaccatccctctggtg
tgcatctacatgctctccaccaacatcctgctggtcaatctgctcgttgccatgtttggc
tacacagtgggaacggtccaggagaacaacgatcaggtctggaagttccagaggtacttc
ttggtgcaggagtactgcaaccgcctgaacatccccttcccctttgtggtcttcgcctac
ttctacatggtggtcaagaagtgcttcggatgctgctgcagggagaaacacgccgagcct
tctgcctgctgtttcagaaatgaagacaatgagactctggcatgggagggtgtcatgaaa
gaaaattaccttgtcaagatcaacacgaaggccaatgacacctcacaggaaatgaggcat
cggtttagacagctggatacaaagattaatgatctcaagggccttctgaaagagatcgct
aataaaatcaaatag

DBGET integrated database retrieval system