KEGG   Canis familiaris (dog): 486262Help
Entry
486262            CDS       T01007                                 

Gene name
KDM2B
Definition
(RefSeq) lysine-specific demethylase 2B isoform X4
  KO
K10276  F-box and leucine-rich repeat protein 10/11 [EC:1.14.11.27]
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cfa04121]
    486262 (KDM2B)
   03036 Chromosome and associated proteins [BR:cfa03036]
    486262 (KDM2B)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.27  [histone-H3]-lysine-36 demethylase
     486262 (KDM2B)
Ubiquitin system [BR:cfa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     486262 (KDM2B)
Chromosome and associated proteins [BR:cfa03036]
 Eukaryotic Type
  Histone modification proteins
   Histone demethylases
    486262 (KDM2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PHD_4 zf-CXXC F-box JHD F-box-like Cupin_8 JmjC PHD
Motif
Other DBs
NCBI-GeneID: 486262
NCBI-ProteinID: XP_005636243
Ensembl: ENSCAFG00000008259
VGNC: 42321
Position
26
AA seq 1313 aa AA seqDB search
MEAEKDSGRRLRPIDRQRYDENEDLSDVEEIVSVRGFSLEEKLRSQLYQGDFVHAMEGKD
FNYEYVQREALRVPLIFREKDGLGIKMPDPDFTVRDVKLLVGSRRLVDVMDVNTQKGTEM
SMSQFVRYYETPEAQRDKLYNVISLEFSHTKLEHLVKRPTVVDLVDWVDNMWPQHLKEKQ
TEATNAIAEMKYPKVKKYCLMSVKGCFTDFHIDFGGTSVWYHVFRGGKIFWLIPPTLHNL
ALYEEWVLSGKQSDIFLGDRVERCQRIELKQGYTFFIPSGWIHAVYTPVDSLVFGGNILH
SFNVPMQLRIYEIEDRTRVQPKFRYPFYYEMCWYVLERYVYCVTQRSYLTQEYQRESMLI
DAPRKPSIDGFSSDSWLEMEEESCEQQPQEEEKEEEEEEEEEEEGADKVPKPPADGPPSP
TSTPSEDQEAPGKKPKAPAMRFLQRTLSNESEESVKSTTVPTDYPKTPTGSPATGVSAKW
THLTEFELKGLKALVEKLESLPENKKCVPEGIEDPQALLEGVKNVLKEHADDDPSLAITG
VPVVTWPKKTPKNRAVGRPKGKLGPASAVKLAANRTTAGARRRRTRCRKCEACLRTECGE
CHFCKDMKKFGGPGRMKQSCIMRQCIAPVLPHTAVCLVCGEAGKEDTVEEEEGKFNLMLM
ECSICNEIIHPGCLKIKESEGVVNDELPNCWECPKCNHAGKTGKAYKQKRGPGFKYASNL
PGSLLKEQKMNRDNKEGQEPAKRRSECEEAPRRRSDEHPKKVPPDGILRRKSDDVHLRRK
RKYEKPQELSGRKRASTLQTSPGSSSHLSPRPPLGSSLSPWWRSSLTYFQQQLKPGKEDK
LFRKKRRSWKNAEDRMALANKPLRRFKQEPEDDLPEAPPKARESDHSRSSSPTAGPSTEG
AEGPEEKKKVKIRRKRRLPTKELSKELSKELNQEIQKTENSLANENHQPIKSEPESESEE
PKRPLGLCERPHRFSKGLTGTPRELRHQLGPGLRSPPRVISRPPPSVSPPKCIQMERHVI
RPPPISPPPDSLPLDDGAAHVMHREVWMAVFSYLSHQDLCVCMRVCRTWNRWCCDKRLWT
CIDLNHCKSITPLMLSGIIRRQPVSLDLSWTNISKKQLSWLINRLPGLRDLVLSGCSWIA
VSALCSSSCPLLRTLDVQWVEGLKDAQMRDLLSPPTDNRPGQMDNRSKLRNIVELRLAGL
DITDASLRLIIRHMPLLSKLHLSYCNHVTDQSINLLTAVGTTTRDSLTEINLSDCNKVTD
QCLSFFKRCGNICHIDLRYCKQVTKEGCEQFIAEMSVSVQFGQVEEKLLQKLS
NT seq 3942 nt NT seq  +upstreamnt  +downstreamnt
atggaggcagagaaagactctggaagaagattgcgcccgattgaccgccagagatacgac
gagaacgaggacttgtcggacgtggaggagatcgtcagcgttcgcggcttcagcctggag
gagaagctgcgcagtcagctgtaccagggggacttcgtgcacgccatggagggcaaagat
ttcaactacgagtatgtgcagagagaagcgctcagggttcccctgatatttcgagaaaag
gatggcctggggattaagatgcccgaccctgatttcacagtccgagatgtcaaactccta
gtgggtagccggcggctggtggatgtgatggatgtgaacacccagaagggcacggagatg
agcatgtcccagtttgtgcggtactacgagaccccggaggctcagcgggacaagctgtac
aacgtcatcagccttgagttcagccacaccaagctggagcacctggtcaagcgtccgact
gtggtagacctggtggactgggtggacaacatgtggccacagcatctgaaggagaagcag
acagaagccacgaatgccattgcggagatgaaatacccgaaagtgaagaagtactgtctg
atgagcgtgaaaggctgtttcactgacttccacatcgactttggaggcacttccgtttgg
taccatgttttccggggtgggaagatcttttggctgattcctccaaccctgcacaatttg
gcactgtacgaggagtgggtgctgtcaggcaaacagagtgacatcttcctgggagaccgc
gtggagcgatgccaaagaattgagctgaaacagggctacacgtttttcatcccttccggt
tggattcatgcagtctacacccccgtagactctctggtatttggcggaaacatcctgcac
agctttaacgtgcccatgcagctgcggatctatgagatcgaggacagaacacgggtgcag
cccaaatttcgttaccccttctactatgagatgtgctggtatgtcttggaaagatacgtg
tactgtgtgacccagcggtcctacctcactcaggaataccagagagaatccatgcttatt
gatgccccaagaaagcccagcatagacggcttctcatctgattcctggttggagatggag
gaagagtcttgtgagcagcagcctcaagaggaggagaaggaggaggaagaggaggaggag
gaggaggaggagggtgcagataaggtgcccaagcctcccgctgatggccctccgtcaccc
accagcaccccttcagaggaccaggaggcccctgggaagaagcccaaagcacctgccatg
cggttcctccaaaggactttgtctaacgagtcagaagaaagtgtgaagtccacgacggtg
cccacagactaccctaagacacccactggctcccctgccacgggggtctccgccaagtgg
acccacctcactgagtttgagctgaagggcctgaaagcgctggtggagaaactggaatcc
ctcccagagaacaagaagtgtgtccctgagggcatcgaggacccccaggcactcctggag
ggtgtgaagaatgtcctgaaggagcacgcggatgacgaccccagtctggccatcactggg
gtccctgtagtcacttggccaaagaagactccaaagaaccgggcggtaggtcggcccaag
gggaagctgggcccagcctctgccgtgaagttggccgccaaccggacaacggcgggagct
cgccggcgccggacgcgatgccgcaagtgcgaggcctgcctgcggaccgagtgtggagag
tgccacttctgcaaggacatgaagaagttcgggggccccgggcggatgaagcagagctgc
atcatgcgacagtgcatcgcgccagtgctgccccataccgccgtgtgcctggtgtgtggc
gaggcagggaaggaagacacagtggaagaggaagaaggaaagtttaacctcatgctcatg
gagtgctccatctgcaatgaaatcatccaccctggatgccttaagattaaggagtcagag
ggcgtggtcaacgatgagcttccaaactgctgggagtgtccgaagtgtaaccacgccggc
aagaccgggaaagcctacaagcaaaagcgtggccctggctttaagtatgcctccaacctg
cccggctccctgctcaaggaacagaagatgaaccgggacaataaggaaggacaggagccc
gccaagcggcggagtgagtgtgaggaggcgcctcggcgcaggtccgacgagcaccccaag
aaggtgcccccggatggcatcctgcgccgaaagtcggacgatgtgcacttgaggaggaag
cggaaatacgagaagccccaagagctgagcgggcgcaagcgagcctcgacgcttcaaacg
tcccccggttcctcctctcacctctcgccgaggccccctctaggcagcagcctcagtccc
tggtggagatccagtctcacttacttccagcagcagctaaaacctggcaaagaagataag
cttttcaggaaaaagcggcggtcctggaagaacgccgaggaccggatggctctggccaat
aagcctctccggcgcttcaagcaggagccggaggatgacctgcccgaggcaccccccaag
gcccgggagagcgaccactcacgctccagctcccccacagctggacccagcacagagggg
gcagagggccctgaggagaagaaaaaggtaaagatacgtaggaaaaggcggcttcccacc
aaggagctgagcaaggagctgagcaaggagctgaaccaagagatccagaagacggagaac
agcctggccaacgagaaccaccagcccatcaagtcagagcccgagagtgagagcgaagag
cccaagcggcccctgggcctctgcgagcgcccccaccgcttcagcaaggggctcactggc
accccccgggagctgcgacaccagctggggcccggcttgcgcagcccaccccgtgtcatc
tcccggccccctccctccgtgtccccacccaagtgcatccagatggagcgacacgtgatt
cggccaccccccatcagccccccgcctgactcgctgcccctggatgatggggcggcccac
gtcatgcacagggaggtgtggatggccgtcttcagctacctcagccaccaagacttgtgt
gtctgcatgcgggtctgcaggacctggaaccgctggtgctgcgataagcggttatggacc
tgcatcgatctgaaccactgcaagtccatcacacccttgatgctgagcggcatcatccgg
cggcagccagtctccctggacctcagctggaccaatatctccaagaaacagctgagctgg
ctcatcaaccggttgcctgggcttcgagacttggtgctgtcgggctgctcgtggattgcg
gtctcagctctctgtagctctagctgtccgttactccggaccctggatgtccagtgggta
gaaggactaaaggacgcccagatgcgggatctcctgtccccacccacagataacaggcca
ggtcagatggacaatcggagcaagctccggaacattgtggagcttcgtctagcaggcctg
gacatcacggacgcctccctgcggctcatcatacgccacatgcccctgctctccaagctc
caccttagttactgtaatcatgttactgaccagtccatcaacctgctcaccgctgtgggc
accaccacccgagactccttaaccgaaatcaacctatcagactgcaataaggttactgac
cagtgcctgtccttcttcaaacgctgtggaaatatctgtcatattgatctgaggtactgc
aagcaagttaccaaggaaggctgtgagcagttcatagctgaaatgtctgtgagcgtccag
tttgggcaagtggaagaaaaactcctgcagaagctgagttag

DBGET integrated database retrieval system