KEGG   Canis lupus familiaris (dog): 486346
Entry
486346            CDS       T01007                                 

Gene name
CABP7
Definition
(RefSeq) calcium-binding protein 7
  KO
K23849  calcium-binding protein 7/8
Organism
cfa  Canis lupus familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:cfa04990]
    486346 (CABP7)
Domain-containing proteins not elsewhere classified [BR:cfa04990]
 EF-hand domain-containing proteins
  Calcium binding proteins
   486346 (CABP7)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_9 EF-hand_4
Other DBs
NCBI-GeneID: 486346
NCBI-ProteinID: XP_543472
Ensembl: ENSCAFG00000012334
VGNC: 38627
UniProt: E2RTJ6
Position
26
AA seq 215 aa
MPFHPVTAALMYRGIYTVPNLLSEQRPVDIPEDELEEIREAFKVFDRDGNGFISKQELGT
AMRSLGYMPNEVELEVIIQRLDMDGDGQVDFEEFVTLLGPKLSTSGIPEKFHGTDFDTVF
WKCDMQKLTVDELKRLLYDTFCEHLSMKDIENIIMTEEESHLGTAEECPVDVETCSNQQI
RQTCVRKSLICAFAIAFIISVMLIAANQVLRSGMK
NT seq 648 nt   +upstreamnt  +downstreamnt
atgccgttccacccggtgacggcggcgttgatgtaccggggcatctacaccgtgcccaac
ctgctgtcggagcagcgccccgtggacatccccgaggacgaactggaggagatccgtgag
gccttcaaagtctttgatcgcgatggcaatggcttcatctccaagcaggagctgggcacg
gccatgcgctccctgggctacatgcccaacgaggtggagctggaagttatcatccagcgg
ctggacatggatggcgatggccaagtggacttcgaggagtttgtgaccctcctgggaccc
aagctttccacctcggggatcccagagaagttccacggcactgactttgacaccgtcttc
tggaagtgcgacatgcagaagctgaccgtggacgagctgaagcggctgctgtacgacacc
ttctgtgagcacctgtccatgaaggacattgagaacatcatcatgacagaggaggaaagc
cacctgggcacagccgaggagtgccccgtggacgtggagacctgctccaaccagcagatc
cgccagacgtgcgtgcgcaagagtctgatctgcgccttcgccatcgccttcatcatcagc
gtcatgctcatcgcagccaaccaggtgctgcgcagcggcatgaagtag

DBGET integrated database retrieval system