KEGG   Canis lupus familiaris (dog): 486433
Entry
486433            CDS       T01007                                 

Gene name
KLHL22
Definition
(RefSeq) kelch-like protein 22
  KO
K10459  kelch-like protein 22
Organism
cfa  Canis lupus familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cfa04121]
    486433 (KLHL22)
Ubiquitin system [BR:cfa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     486433 (KLHL22)
SSDB
Motif
Pfam: Kelch_1 Kelch_6 BTB Kelch_3 Kelch_2 Kelch_4 BACK Kelch_5
Other DBs
NCBI-GeneID: 486433
NCBI-ProteinID: XP_543559
Ensembl: ENSCAFG00000014906
VGNC: 42457
UniProt: E2RD68
Position
26
AA seq 634 aa
MAEEQEFTQLCKLPVQPSHPHCVNNTYRSAQHSQALLRGLLALRDSGILFDVVLVVEGRH
IEAHRILLAASCDYFRGMFAGGLKEMEQEEVLIHGVSYNAMCQILHFIYTSELELSLSNV
QETLVAACQLQIPEIIHFCCDFLMSWVDEENILDVYRLAELFDLSRLTEQLDTYILKNFV
AFSRTDKYRQLPLEKVYSLLSSNRLEVSCETEVYEGALLYHYTLEQVQADQISLHEPPKL
LETVRFPLMEAEVLQRLHDKLDPSPLRDTVANALMYHRNESLQPSLQGPQTELRSDFQCV
VGFGGIHSTPSTVLSDQAKYLNPLLGEWKHFTASLAPRMSNQGIAVLNNFVYLIGGDNNV
QGFRAESRCWRYDPRHNRWFQIQSLQQEHADLCVCVVGRYIYAVAGRDYHNDLNAVERYD
PATNSWAYVAPLKREVYAHAGATLEGKMYVTCGRRGEDYLKETHCYDPDSNTWHSLADGP
VRRAWHGMATLLDKLYVIGGSNNDAGYRRDVHQVACYSCTSGQWSSVCPLPAGHGEPGIA
VLDTRIYVLGGRSHNRGSRTGYVHIYDVEKDCWEEGPQLDNSISGLAACVLTLPRSLLLE
PPRGTPDRSQADPDFASEVMSVSDWEEFDNSSED
NT seq 1905 nt   +upstreamnt  +downstreamnt
atggcggaggagcaggagttcacccagctgtgcaagttgcctgtgcagccctcacacccg
cattgtgtcaacaacacctaccggagtgcacagcactcccaggccttgctccgggggctg
ctggctctccgggacagtggcatcctctttgatgttgtcctggtggtggaggggagacac
attgaggcccatcgaatcctattggctgcatcctgcgattatttcagaggaatgtttgct
gggggactgaaggagatggagcaggaagaggtcctgatccacggtgtgtcctataatgcc
atgtgccaaatcctgcatttcatttatacctccgagttggagctcagcctgagcaatgtc
caggagacgctggttgccgcctgccagctgcagatcccggaaatcattcatttctgctgt
gatttcctcatgtcctgggtggatgaagagaacatccttgatgtttaccggctggcggag
ctatttgacttgagccgtctgactgagcagctggacacctacatcctcaaaaactttgtg
gccttctcacggactgacaagtaccgccagcttcccctggagaaggtctactccctcctc
agcagtaaccgcctggaggtctcctgtgagaccgaggtatatgagggtgccctgctctac
cattacaccctggagcaggtacaggctgaccagatctcactgcacgagccccccaagctc
cttgagacagtacgttttcccctgatggaagctgaggtcctccagcggctgcacgataag
ctggaccccagcccgctgagggacacggtggccaatgccctcatgtaccaccgcaacgag
agcctgcagcccagcctgcagggccctcagacggagctgcggtcggacttccagtgcgtc
gtgggctttgggggcattcactccacgccatccactgtcctcagtgaccaagccaagtac
ctgaaccccctgctgggagagtggaagcacttcaccgcctccctggccccccgcatgtcc
aaccagggcatcgcggtgctcaacaactttgtgtacctgattggaggggacaacaatgtg
cagggcttccgtgccgagtcccggtgctggaggtatgacccaaggcacaaccgctggttc
cagatccagtccctgcagcaggagcacgccgacctgtgtgtgtgtgttgtgggcaggtac
atctatgcggtggcgggccgcgactaccataatgatctgaatgctgtggagcgttacgat
cccgccaccaactcctgggcttacgtggctccgctcaagagggaggtatatgcccacgcg
ggcgccacgctggaggggaagatgtacgttacttgtggccgcagaggggaagactaccta
aaggagacgcactgctacgacccagacagcaacacctggcacagtctggctgatgggccc
gtgcggcgagcctggcacggcatggctaccctcctggacaagctgtacgtgatcgggggt
agcaacaatgacgctggctacaggagggatgtgcaccaggtggcctgctacagctgcaca
tccgggcagtggtcatctgtctgcccactcccggccggccacggcgagcctggcattgct
gtgctggacaccaggatctatgtgctgggtggccgctcacacaaccgtggcagccgcacg
ggctacgtgcacatctatgacgtggagaaggactgctgggaggagggcccgcaactggac
aactccatctcaggcctggcagcctgcgtactcaccctgccccgctccctgctcctcgag
ccgcctcgtgggactccggaccgcagccaggctgacccggactttgcctccgaggtgatg
agcgtgtctgactgggaggagtttgacaactcaagcgaggactag

DBGET integrated database retrieval system