KEGG   Canis familiaris (dog): 486462Help
Entry
486462            CDS       T01007                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00010  Glycolysis / Gluconeogenesis
cfa00562  Inositol phosphate metabolism
cfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    486462 (MINPP1)
   00562 Inositol phosphate metabolism
    486462 (MINPP1)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     486462 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     486462 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708 SID
Motif
Other DBs
NCBI-GeneID: 486462
NCBI-ProteinID: XP_543588
Ensembl: ENSCAFG00000028821
UniProt: J9NWC7
Position
26
AA seq 274 aa AA seqDB search
MECGPPRINDKLMRFFDHCEKFLTEVEKNATALYHVEAFKTGPEMQNILKKVAATLQVPV
HSLNADLIQVAFFTCSFDLAIKGVKSPWCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINS
RSSCTLFQDIFQHLDKAIEQKQRSQPVSSPVILQFGHAETLLPLLALMGYFKDKEPLTAY
NYKEQLHRKFRSGHIVPYASNLIFVLYHCKNAKTPKEEFRVQMLLNEKVLPLAHSQETAS
LYEDLKAHYKDILQSCHSSKECELAKVNNTSDEL
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggaatgtggacctccaagaattaatgataaactaatgaggttctttgatcattgtgag
aagtttttaactgaagtggaaaagaatgctacggctctttatcatgtagaagctttcaaa
actggaccagaaatgcagaacattttaaaaaaggttgctgctactttgcaagtgccagtc
cacagtttaaatgcagatttaattcaggtagcttttttcacctgttcatttgacctggca
attaaaggtgttaaatctccttggtgtgatgtttttgacatagatgacgcaaaggtatta
gaatatttaaatgacttgaagcaatattggaaaagaggctatgggtatactattaatagt
cgatccagctgcaccctgtttcaggatatcttccagcacttggacaaagcaattgaacag
aaacaaaggtctcagccagtttcctctccggtcatccttcagtttggtcatgcagagacc
cttcttccactgctcgctctcatgggctacttcaaagacaaggagcccctcacggcttac
aattacaaggaacaactgcatcgcaagttccgaagcggccacatcgtgccctacgcctcc
aacctgatattcgtgctttaccactgtaaaaatgccaagactccgaaggaggaattccga
gtgcagatgctgttgaatgagaaggtcttgccattggctcactcacaagaaaccgcctcc
ttatacgaggatctaaaggcccactacaaggacatccttcagagctgtcattccagcaag
gagtgtgagttagcaaaggtgaacaacacgtctgatgagctatga

DBGET integrated database retrieval system