KEGG   Canis familiaris (dog): 486670Help
Entry
486670            CDS       T01007                                 

Definition
(RefSeq) histone H4
  KO
K11254  histone H4
Organism
cfa  Canis familiaris (dog)
Pathway
cfa05034  Alcoholism
cfa05203  Viral carcinogenesis
cfa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    486670
  09163 Immune disease
   05322 Systemic lupus erythematosus
    486670
  09165 Substance dependence
   05034 Alcoholism
    486670
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cfa03036]
    486670
Chromosome and associated proteins [BR:cfa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    486670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137
Motif
Other DBs
NCBI-GeneID: 486670
NCBI-ProteinID: XP_543797
Ensembl: ENSCAFG00000012989
UniProt: F2Z4N2
Position
27
AA seq 103 aa AA seqDB search
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgtccgggcgcgggaaaggcggcaaagggctgggcaagggaggcgccaagcgccaccgg
aaggtcctgcgggacaacatccagggcatcacgaagcccgccatccgccggcttgcccgc
cgaggcggggtgaagcgcatttctgggctcatctacgaggagacccgcggggtgctcaag
gtgttcctggagaacgtgatccgcgacgcggtgacctacacggagcacgccaagcgcaag
acggtcaccgccatggacgtggtctacgcgctcaagcgccagggccgcaccctgtacggc
ttcggcggctga

DBGET integrated database retrieval system