KEGG   Canis familiaris (dog): 486810Help
Entry
486810            CDS       T01007                                 

Gene name
ENTPD1
Definition
(RefSeq) ectonucleoside triphosphate diphosphohydrolase 1 isoform X1
  KO
K01510  apyrase [EC:3.6.1.5]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00230  Purine metabolism
cfa00240  Pyrimidine metabolism
cfa01100  Metabolic pathways
cfa05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    486810 (ENTPD1)
   00240 Pyrimidine metabolism
    486810 (ENTPD1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    486810 (ENTPD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:cfa04090]
    486810 (ENTPD1)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.5  apyrase
     486810 (ENTPD1)
CD molecules [BR:cfa04090]
 Proteins
  486810 (ENTPD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDA1_CD39
Motif
Other DBs
NCBI-GeneID: 486810
NCBI-ProteinID: XP_005637612
Ensembl: ENSCAFG00000008433
UniProt: J9P8J9
Position
28
AA seq 509 aa AA seqDB search
MEDRKESELKSFCSRNILIILGFSCIMAVVALIAVGLTQNKPLPENVKYGIVLDAGSSHT
SLYIYKWPAEKENDTGVVNQIEECKLKGPGISRYAHKLSEIDIYLTECMIRASQVIPKSQ
HEETPVYLGATAGMRLLRIEDAQLADKVLAAVTKSLSNYHFDFQGARIITGQEEGAYGWI
TINYLLGKFIQKLNWLYLRPDENGAQETFGALDLGGASTQITFVPQNKNIESPRNALHFR
LYGRDYSVYTHSFLCYGKDQALRQKLAKDIRGTDGILRDPCFHPGYETVMNVSDLYSSPC
TRRFAMIHPFSQFQIQGTGNYRQCQRSILELFNTSYCPYSQCSFNGIFLPPPHGDFGAFS
AYYYVMDFLNLTLEETTSQEKVIDTMEKFCSQPWEELKTYFGDVKEKYLSEYCFSGTYIL
SLLSSYHFTADSWKNIHFMGKIQSSNVGWTLGYMLNLTNMIPAEQPYSKPLSHTTYIFLM
ILFSLILVAVVIIGLLVFYKPSYFWKDMV
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggaagatagaaaggagtctgaactgaagagtttttgttccagaaatatactgatcatc
cttggcttctcctgtatcatggctgtagttgctttgattgctgtggggctgacccagaac
aaaccattgccagaaaatgttaagtatgggattgtgctggatgcaggctcttctcacaca
agtttgtacatctataagtggccagcagaaaaggagaatgacactggggtggtgaatcag
atagaagagtgcaagctgaaaggtcctggaatctcaagatatgctcacaaattaagtgaa
atagacatttatctgactgaatgcatgataagagccagtcaggtgattccaaagtcccaa
catgaagagacccctgtttacctgggagctacggcaggcatgcggttgctcaggatagaa
gatgcacagctggcagacaaggtcttagctgcagtgacaaaaagcctcagcaactaccac
tttgacttccagggtgccagaatcatcactggccaagaagaaggtgcctatggctggatt
actatcaactatctgctgggcaaattcattcagaaattgaattggctctacctgaggcca
gatgaaaacggtgctcaggaaaccttcggggctttagaccttgggggagcctctacacaa
atcacttttgtaccccaaaacaagaatattgagtctccaagaaatgctctgcactttcgc
ctctatggcagggactacagcgtgtacacgcacagcttcttgtgctatgggaaggatcaa
gcactcaggcagaaactggccaaggacattcggggtacagatggaatcctcagggaccca
tgctttcaccctggatatgagacagtaatgaatgtaagtgacctctacagtagcccctgc
accaggagatttgcaatgattcatccattcagtcagtttcaaatccagggcactggaaac
tatcggcaatgccagcgaagcatccttgaactcttcaacaccagttactgcccttactcc
cagtgttccttcaatgggattttcttgccaccacctcatggggattttggggcattttcg
gcttactactatgtgatggattttctgaaccttacattagaggaaaccacctctcaggaa
aaggtgattgacacgatggaaaagttctgctctcagccttgggaggagctgaagacatat
tttggtgacgtgaaggagaaatacttaagtgaatactgcttttctggaacctacatcctc
tctctcctgagtagctatcatttcacagcggattcctggaagaatattcatttcatgggc
aagatccaaagcagcaatgtcgggtggactctgggctacatgctgaacctgaccaacatg
atcccagccgagcagccgtattccaagcctctctcccacaccacctacatcttcctcatg
atcctcttctccctgatcctggtcgcagtggtcatcataggcttgcttgtcttttacaag
ccttcatatttctggaaagacatggtatag

DBGET integrated database retrieval system