KEGG   Canis lupus familiaris (dog): 486998
Entry
486998            CDS       T01007                                 
Symbol
RDH10
Name
(RefSeq) retinol dehydrogenase 10 isoform X1
  KO
K11151  retinol dehydrogenase 10 [EC:1.1.1.-]
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa00830  Retinol metabolism
cfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    486998 (RDH10)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-
     486998 (RDH10)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR
Other DBs
NCBI-GeneID: 486998
NCBI-ProteinID: XP_849875
Ensembl: ENSCAFG00000008031
VGNC: 45452
Position
29:22150310..22176734
AA seq 341 aa
MNIVVEFFVVTFKVLWAFVLAAARWLVRPKEKSVAGQVCLITGAGSGLGRLFALEFARRR
ALLVLWDINTQSNEETAGMVRHIYRDLEAADAAALQAGNGEEEILPHCNLQVFTYTCDVG
KRENVYLTAERVRKEVGEVSVLVNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAF
LPTMLEINHGHIVTVASSLGLFSTAGVEDYCASKFGVVGFHESLSHELKAAEKDGIKTTL
VCPYLVDTGMFRGCRIRKEIEPFLPPLKPDYCVKQAMKAILTDQPMICTPRLMYIVTFMK
SILPFEAVVCMYRFLGADKCMYPFIAQRKQATNNNEAKNGI
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgaacatcgtggtcgagttcttcgtggtgactttcaaagtgctctgggcgttcgtgctg
gcggcggcgcgctggctggtgcggcccaaggagaagagcgtggcgggccaggtgtgcctc
atcacgggcgccggcagcggcctgggccgcctcttcgcgctcgagttcgcgcggcgccgg
gcgctgctggtgctctgggacatcaacacccagagcaacgaggagacggcgggcatggtg
cgccacatctaccgcgacctggaggcggccgacgccgcggcgctgcaagctgggaatggt
gaggaagaaattctgccccactgtaacttgcaggtttttacctacacctgtgatgtggga
aagagggagaatgtctacctgacagcagaaagggtccgcaaggaggttggcgaggtctca
gtcctggtcaataatgccggcgtggtctctgggcatcatcttctggaatgtcctgatgag
ctcattgagagaaccatgatggtcaattgccacgcacacttctggaccactaaggctttc
cttcccaccatgctggagattaatcatggtcatattgtgacagttgcaagttccttggga
ttgttcagtactgctggagttgaggattattgtgccagtaagtttggagtggtgggtttt
catgaatccctgagccatgagctaaaggctgctgaaaaggatggaattaaaacaacattg
gtttgcccttaccttgtagacacgggcatgttccgaggctgccgaatcaggaaagaaatt
gagccttttctgcctcctctgaagcctgattactgtgtgaagcaggccatgaaggccatc
ctcaccgatcagcccatgatctgcaccccccgcctcatgtacatcgtgactttcatgaag
agcatcctcccttttgaagcagttgtgtgcatgtatcggttcctaggagcagacaagtgt
atgtacccgtttattgctcaaagaaaacaagccacaaacaataatgaagcgaaaaatggc
atctaa

DBGET integrated database retrieval system