KEGG   Canis familiaris (dog): 487030Help
Entry
487030            CDS       T01007                                 

Gene name
CA13
Definition
(RefSeq) carbonic anhydrase 13
  KO
K01672  carbonic anhydrase [EC:4.2.1.1]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00910  Nitrogen metabolism
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    487030 (CA13)
Enzymes [BR:cfa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     487030 (CA13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carb_anhydrase
Motif
Other DBs
NCBI-GeneID: 487030
NCBI-ProteinID: XP_013964802
Ensembl: ENSCAFG00000030792
VGNC: 38608
UniProt: J9NSG2
Position
29
AA seq 262 aa AA seqDB search
MSRLSWGYGEHNGPIHWNKFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDANSAKII
SNSGHSFSVDFDDTEDKSVLRGGPLTGSYRLRQFHLHWGSADDHGSEHVVDGVRYAAELH
VVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEHNSQLQKITDILDSIKEKGKQTRFTNF
DPLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLATFRTLLCTAEGEAAA
FLLSNHRPPQPLKGRKVRASFH
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcggctcagctggggatacggcgagcacaacggtcctattcattggaataaattt
ttccctattgctgatggggatcaacaatctccgattgagattaaaaccaaagaagtgaaa
tatgactcttctctgcgacctcttagtatcaagtatgatgcaaactcagccaaaatcatc
agtaatagtggccattccttcagcgttgactttgatgacacggaggacaaatcagttcta
cgtgggggtcctctcactggaagctaccgcttgcgacagtttcaccttcactgggggtct
gctgatgatcacggctctgaacacgtggtggatggagtgagatacgcggcagagctccat
gtcgttcattggaattccgacaaataccccagttttgttgaggcagctcacgagccagat
ggactagctgtcttgggagtatttttacagatcggtgaacataattctcaactgcaaaag
attactgatattttggattctattaaagaaaagggcaaacaaactcgattcacaaatttt
gatccactatctctgctccctccatcctgggactactggacatatcccggttccctgaca
gtcccgcctcttcttgagagtgtcacatggatcgttttaaaacaacctataaatatcagc
tctcaacagctggccacattccgcactctcctctgcacagcggagggcgaagcagcggcc
tttttgttgagcaaccaccgcccaccacagcctctgaagggccgaaaagtgagagcttct
ttccattaa

DBGET integrated database retrieval system