KEGG   Canis lupus familiaris (dog): 487044
Entry
487044            CDS       T01007                                 

Symbol
RUNX1T1
Name
(RefSeq) LOW QUALITY PROTEIN: protein CBFA2T1
  KO
K10053  CBFA2/RNUX1 translocation partner 1
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa05200  Pathways in cancer
cfa05202  Transcriptional misregulation in cancer
cfa05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    487044 (RUNX1T1)
   05202 Transcriptional misregulation in cancer
    487044 (RUNX1T1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    487044 (RUNX1T1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:cfa04990]
    487044 (RUNX1T1)
Domain-containing proteins not elsewhere classified [BR:cfa04990]
 Zinc finger domain-containing proteins
  MYND-type zinc finger domain-containing proteins
   487044 (RUNX1T1)
SSDB
Motif
Pfam: NHR2 TAFH zf-MYND DUF3731 Efg1 MAJIN
Other DBs
NCBI-GeneID: 487044
NCBI-ProteinID: XP_544173
VGNC: 80256
Position
29
AA seq 663 aa
MCHPDKPFTSDKLRCVFNEYKAAVWVPPRLRPLSCAPLPEAGGENLHLKISGERKRNLPF
VVRGEEEASXPGLAAISHHLCDPDRTRRDRTEKHSTMPDSPVDVKTPSRLTPPTMPPPPT
TQGAPRTSSFTPTTLTNGTSHSPTALNGAPSPPNGFSNGPSSSSSSSLANQQLPPACGAR
QLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFV
IPFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQLLLDASTTSPVDSSELLLDVNENGK
RRTPDRTKENGFDREPLHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYR
LDDMAIAHHYRDSYRHPSHRDLRDRNRPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHLL
NCIMDMVEKTRRSLTVLRRCQEADREELNYWIRRYSDAEDLKKGGGGGGGHSRQQSPVNP
DPVALDAHREFLHRPASGYVPEEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMITT
ERAKMERTVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQH
KDWEKHHHICGQTLQAQQQGDTPAVSSSVTPNSGAGSPMDTPPAATPRSTTPGTPSTIET
TPR
NT seq 1992 nt   +upstreamnt  +downstreamnt
atgtgccatcctgacaagccttttacttctgataagctccgatgtgtgtttaatgaatac
aaagccgcggtctgggtgccgcctcggctgcggccgctctcctgcgctcctttgccagaa
gctggcggagagaatttacatttaaagattagcggagagagaaagagaaatctgcctttt
gttgtgcggggtgaggaggaggcatcangtcctggcctggccgctatctcccatcacctc
tgcgacccagacaggactcggcgagatcggactgagaagcactccacgatgccagactca
cctgtggatgtgaagaccccgtctaggctgactcctcctaccatgccacctccccccaca
actcaaggagctccgagaacgagttcatttacaccgacgactttaactaatggcacgagc
cattcacccacagccttgaatggcgccccctcgccgcccaatggctttagcaatgggcct
tcctcttcttcctcctcttctctggctaatcaacagctgcccccagcctgtggcgccagg
cagctcagtaagctgaaacggttccttactaccctgcagcagtttggcaatgacatttct
ccagagataggagagagagtccgcaccctcgtactaggactggtgaactctactttgaca
attgaagaatttcattccaaactgcaagaagctactaacttcccactgcgaccttttgtc
atcccatttctgaaggccaacctgcccctgctgcagcgcgagctcctccactgcgcaagg
ctggccaaacagaaccctgcccagtacctcgcccagcatgaacagctgcttctggatgcc
agcaccacctcacctgttgactcctcagagctgcttctcgatgtgaacgaaaacgggaag
aggcgaactccagacagaaccaaagaaaatggctttgacagagagcctttgcactcagaa
catccaagcaagcgaccatgcactattagcccaggccagcggtacagtccaaataacggc
ttatcctaccagcccaatggcctgcctcaccccaccccacctccacctcagcattaccgt
ttggatgatatggccattgcccaccactacagggactcctatcgacaccccagccacagg
gacctcagggacagaaacagacctatggggttgcatggcacacgtcaagaagaaatgatt
gatcacagactaacagacagagaatgggcagaggaatggaaacatcttgaccatctgctg
aactgcatcatggacatggtggagaagacgcggcgctccctcacggtgctgcggcgctgc
caggaggccgaccgcgaggagctcaattactggatccggcgctacagcgacgccgaggac
ctgaagaaaggcggcggcggtggcggcggccactccagacagcagagtccggtcaacccg
gacccggttgcactagatgcgcatcgggaattccttcacaggcctgcttctggatacgtg
ccagaggagatctggaagaaagctgaggaggcggtcaacgaggtgaagcgccaggcgatg
accgagctgcagaaggccgtgtccgaggccgagcggaaggcccacgacatgatcaccacc
gagcgcgccaagatggagcgcacggtggccgaggccaagcggcaggcggcggaggatgcg
ctggccgtcatcaaccagcaggaggattcgagcgagagttgctggaactgcggccgcaaa
gctagcgagacgtgcagcggctgtaacacggcccggtactgtggctcattttgccagcac
aaggactgggagaagcaccaccacatctgcggccagaccctgcaggcccagcagcagggg
gacacgcccgctgtcagctcctccgtcacgcccaacagcggggccggcagccccatggac
acaccaccagcagccaccccgaggtcgaccaccccggggaccccctctaccatagagaca
acccctcgctag

DBGET integrated database retrieval system