KEGG   Canis familiaris (dog): 487323Help
Entry
487323            CDS       T01007                                 

Gene name
SDC3
Definition
(RefSeq) syndecan-3
  KO
K16337  syndecan 3
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04514  Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    487323 (SDC3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:cfa00535]
    487323 (SDC3)
Proteoglycans [BR:cfa00535]
 Cell surface proteoglycans
  Syndecan family (transmembrane HSPG)
   487323 (SDC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Syndecan
Motif
Other DBs
NCBI-GeneID: 487323
NCBI-ProteinID: XP_005617740
Ensembl: ENSCAFG00000011234
VGNC: 45943
UniProt: F1Q3P6
Position
2
AA seq 400 aa AA seqDB search
MGAGAQRWRNENFERPVDLEGSGDDDSFPDDELDDLYSGSGSGYFEQESGIETAMRFSPD
VAMAVSTTAAVLPTVDIQPVGTPFEELPSEHPTPEPATSPPVVTEVPEEPSQRATTISTP
TAPTAATTAGALTVATVPATVATAVPSIPAAPPSTATTSVIRTTGVRRLLPLPLTTAATA
RATTPAAPSPPTTVAVLDTEAPTPRMVSTATSRPRALPRPATTQEPDLPEKSTLPLGTTA
PGPTEVAQTPTLESVLTTIRDEPEVPVSGGPSGDFELPEEETTQPDTANEVVAVGGAAAK
PSPPPGTLPKGARPGPGLLDNAIDSGSSAAQLPQKSILERKEVLVAVIVGGVVGALFAAF
LVTLLIYRMKKKDEGSYTLEEPKQASVTYQKPDKQEEFYA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgggggctggggctcagcgctggcgcaacgagaactttgagaggcccgtggacctcgag
ggctctggggatgacgactccttccctgatgatgagctggatgacctctactcagggtcg
ggctcaggctacttcgagcaggagtcgggcattgagacagccatgcggttcagcccggat
gtggccatggcagtgtctactacagctgcagtgctgcccaccgtggacatccagcccgtg
ggcaccccgtttgaagagctcccctctgagcaccccaccccggaaccagccaccagcccc
ccagtggtgacagaggtcccggaagagcccagtcagagagccaccaccatctctactccc
acggctcccacggccgccacgacggcgggggccctgaccgtggccacggtgcccgccacg
gtggccactgccgtccccagcatccctgcggcacccccttccacggccaccacctctgtc
ataaggaccaccggcgtacggaggctcctgcctctcccattgaccacggcagccacggcc
cgggccaccaccccagcggcgccctcccctcccaccacggtggctgtcttggacacagag
gccccaacacccaggatggtcagcacagctacctccaggccgagggcccttcccaggccg
gctaccacccaggagcctgacctccccgagaagagcaccttgcccttggggaccacggcc
cctggccccacggaggtggctcagaccccaactctggagtccgtcctgaccacgatccgg
gatgagcccgaggtgccagtgagcggggggcccagtggggactttgagctgccggaggag
gagaccacacagccagacacagccaatgaggtggtggccgtgggcggggctgcagccaag
ccgtcacctccgccggggacgctgcccaagggtgcgcgccctggcccgggcctcctggac
aatgccatcgactccggcagctcagctgctcagctgcctcagaaaagcatcctggagcgg
aaggaggtgctcgtagctgtgattgtaggtggggtggtgggcgccctgttcgctgccttc
ctagtcacgttactcatctaccgcatgaagaagaaggatgaaggaagctacaccctggag
gagcccaagcaggcgagcgtcacgtaccagaagcctgataagcaggaggaattctacgcc
tag

DBGET integrated database retrieval system