KEGG   Canis familiaris (dog): 487535Help
Entry
487535            CDS       T01007                                 

Gene name
SORD
Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00040  Pentose and glucuronate interconversions
cfa00051  Fructose and mannose metabolism
cfa01100  Metabolic pathways
Module
cfa_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    487535 (SORD)
   00051 Fructose and mannose metabolism
    487535 (SORD)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     487535 (SORD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 487535
NCBI-ProteinID: XP_544659
Ensembl: ENSCAFG00000013672
VGNC: 46662
UniProt: F1PXG0
Position
30
AA seq 356 aa AA seqDB search
MAAAKAENLTLVVHGPGDLRLENYPIPEPGPNEVLLKMHSVGICGSDVHYWQHGRIGDFI
VKKPMVLGHEASGTVVKVGSLVKHLKSGDRVAIEPGALREMDEFCKIGRYNLSPSIFFCA
TPPDDGNLCQFYKHNADFCYKLPDNVTYEEGALIEPLSVGIHACRRAGITLGNKVLVCGA
GPIGLVTLIVAKAMGAGQVLVTDLSASRLSKAKEVGADIVLQISKESPKEIASKVEDMLG
CKPEATIECTGVESAIQSGIYATRAGGTLVLVGLGSEMTTVPLTHASTREVDIKGVFRYC
NTWPMAISMLASKAVNVKPLVTHRFPLEKALEAFETARKGTGLKVMLKCDPNDQNP
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccaaggccgagaacctcaccctggtggtgcacggacccggagacctgcgc
ctggagaactatcctatcccagaaccaggcccaaatgaagtactgctgaagatgcattcc
gtcggaatctgtggctcagatgtccactactggcagcatggtcgaattggggattttatt
gtgaaaaagccaatggtgctggggcatgaagcttcaggaacagtcgtaaaagtgggatca
ctggtaaagcacctaaaatcaggggatcgtgttgccatcgagcctggtgctctgcgagaa
atggatgaattctgcaagattggccggtacaatctgtcaccatctatcttcttctgtgcc
acaccccctgatgatgggaacctctgccagttttataagcacaacgctgacttctgctac
aagcttcctgacaatgtcacctatgaagaaggggccctgattgagccactgtctgtgggg
atccatgcctgtcggcgagctggaatcaccctggggaacaaggtcttagtgtgtggagct
gggccgattggactggtcactctgattgtggccaaggcaatgggtgcaggtcaagtgctg
gtgactgatctgtctgcctctcggttgtctaaagccaaggaagttggggctgatatcgtc
ctccagatctccaaggagagccctaaggaaatagccagtaaagtggaagatatgctgggg
tgcaagccagaagcgaccatcgagtgcacaggggtggagtccgccatccagtcaggcatc
tatgctactcgtgctggggggaccctggtgctcgtagggctgggctccgagatgaccacg
gtgcccctaacacacgcaagcacccgggaggtggatatcaagggcgtgttccgatattgc
aacacgtggccgatggcaatttcaatgcttgcgtccaaggctgtgaatgtaaagccctta
gttactcataggtttcctctggagaaagctctggaggcctttgaaacagccagaaaggga
acggggttgaaagtcatgctcaagtgcgaccccaacgaccagaatccctaa

DBGET integrated database retrieval system