KEGG   Canis familiaris (dog): 488074
Entry
488074            CDS       T01007                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cfa03000]
    488074 (AHRR)
Transcription factors [BR:cfa03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    488074 (AHRR)
SSDB
Motif
Pfam: PAS PAS_3
Other DBs
NCBI-GeneID: 488074
NCBI-ProteinID: XP_022269937
Ensembl: ENSCAFG00000025377
VGNC: 37729
Position
34
AA seq 585 aa
MIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQVVFGQPLHSET
EDAVLGRLLRAQEGGAGSPTDFSAFLTRCFVCRVRCLLDSTSGFLTMQFQGKLKFLFGQK
RKAPSGTVLPPRLSLFCIVVPVLLPSVAEMKMKSAFLRVKHRVDVSASMDAKAKAAAGLC
EPELHGKPNYLAGRSDGENISVLRTPTDAGRWARVPARASCLCLRNGPDLVSNPEGFAGD
RGAEEHGRVPRGRREIHAYSCCFEAPGPTRHLSWMPGKHSQEGSTRVKLEPSKSDPFSMH
AVSRTSCVPCPSLPGAIHSSVAAAFRNPPSCHPGSHSPSAYTSPTSRAFRDSDQGQLHPL
PSCPFPQGSLDSGLPPSRGQRLAVAGYPIEDTKFRGGPMPLGAPCNPILSLDVPIKTESD
SGSEDAADGYSVAPGQLWPGATGVAKRQRVTFPTRMHLKTEPDARHHLYAAHLGQSVLEA
HPSGRAPLRAGRDLAPFPPTHCACLEHVHGPPEPDGPRHLCTQAQQPSSLPCDCQAPEST
PIVKREPLDSPPWASHGQGRVPGMFPKSAMATLMPPKAPECAFLP
NT seq 1758 nt   +upstreamnt  +downstreamnt
atgatattttatgcgtcagcaacaatcgtggactatctgggcttccaccagacggatgtg
atgcaccaaaacatttacgactatatccacgtggacgaccgccaggacttctgccggcag
ctccactgggccatggacccgccgcaggtggtgttcgggcagcccctgcactcagagaca
gaggacgctgtcctggggaggctgctgcgcgcgcaggaggggggcgcgggctcgcccacg
gacttctccgccttcctgacgcgctgcttcgtgtgccgcgtgcgctgcctgctggacagc
acgtcgggcttcctgacaatgcaatttcaaggaaaactaaaattcctgtttggacagaag
aggaaagcgccgtcggggacagtcctgccccctcggctctcgctgttctgcatcgtggtg
cctgtcctcctaccttctgtggcggagatgaagatgaagagcgcatttttgagggtgaag
cacagggtggacgtctcggcctcaatggatgcaaaagcaaaagctgccgcgggtctgtgt
gaaccagaattgcatgggaaacccaactacttagcagggaggagtgatggagaaaacatc
tcagtgctcaggacacccacggacgctggccgctgggcccgggttccagccagggcctca
tgcttgtgtctcaggaatggccctgacctcgtctccaatcccgaggggttcgcaggggac
aggggagcagaggaacacgggagggtgcccagggggcggagggaaatacacgcatacagc
tgctgcttcgaagcaccaggacccacaaggcacctgagctggatgccagggaaacacagt
caggagggcagcaccagggtgaagctggagcccagcaagagtgacccgttctccatgcat
gctgtgtcccgcacttcctgcgtgccctgccccagccttccgggtgccatccactccagt
gtggccgctgctttcaggaatccacccagctgtcacccgggaagccattcccccagtgcc
tacaccagccccacgagcagagcttttcgggacagtgatcagggccagctgcaccctctg
cccagctgccccttcccccaggggagcctggatagtgggctccctccatccagagggcag
cgccttgcagtggcgggctatcccatcgaggacaccaagtttcgaggtgggccaatgccc
ttgggagctccgtgcaaccccattctttcccttgatgtgcccataaagacggagagtgac
tctgggtctgaagatgcagccgacggctactctgtggccccaggccagctgtggccggga
gccactggtgtggccaagagacagcgggtcacgttccctaccaggatgcacctgaaaacg
gagccggatgccaggcaccacctatacgctgcgcacctgggacagagcgtgctggaggct
cacccaagtggccgggctccgctcagagccggcagagacctggcccccttcccccccaca
cactgtgcctgcctggagcacgtgcatggccctcctgagccggatggcccccgccacctc
tgtacgcaggctcagcagccctcttcactgccctgtgactgccaagccccagagtccacg
cccatcgtcaaacgagagcccctggactcaccgccatgggccagtcacggccagggtagg
gtgcctggaatgttccccaaaagtgccatggcaacactgatgccgcccaaagcccctgag
tgtgctttcctgccatag

DBGET integrated database retrieval system