KEGG   Canis familiaris (dog): 488110Help
Entry
488110            CDS       T01007                                 

Gene name
EHHADH
Definition
(RefSeq) peroxisomal bifunctional enzyme isoform X2
  KO
K07514  enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase / 3,2-trans-enoyl-CoA isomerase [EC:4.2.1.17 1.1.1.35 5.3.3.8]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00071  Fatty acid degradation
cfa00280  Valine, leucine and isoleucine degradation
cfa00310  Lysine degradation
cfa00380  Tryptophan metabolism
cfa00410  beta-Alanine metabolism
cfa00640  Propanoate metabolism
cfa00650  Butanoate metabolism
cfa01100  Metabolic pathways
cfa01200  Carbon metabolism
cfa01212  Fatty acid metabolism
cfa03320  PPAR signaling pathway
cfa04146  Peroxisome
Module
cfa_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
cfa_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
cfa_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    488110 (EHHADH)
   00650 Butanoate metabolism
    488110 (EHHADH)
  Lipid metabolism
   00071 Fatty acid degradation
    488110 (EHHADH)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    488110 (EHHADH)
   00310 Lysine degradation
    488110 (EHHADH)
   00380 Tryptophan metabolism
    488110 (EHHADH)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    488110 (EHHADH)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    488110 (EHHADH)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    488110 (EHHADH)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     488110 (EHHADH)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     488110 (EHHADH)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     488110 (EHHADH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2 TrkA_N NAD_binding_2 2-Hacid_dh_C ApbA
Motif
Other DBs
NCBI-GeneID: 488110
NCBI-ProteinID: XP_005639851
Ensembl: ENSCAFG00000013218
VGNC: 40250
Position
34
AA seq 721 aa AA seqDB search
MHGNPRRNESLDSKRCLLSCCNCTAVLRGIKDGLQKATTDRTVKAIVLCGADGKFSAGAD
IHSFGEPRKSDFVLGHIVDEIQRTEKPVVAAIQGLALGGGLELALGCHYRIAHAEAQIGF
PEVTLGILPGARGTQLLPRLIGVPAALDLITSGRHVLADEALKLGILDEIVNSDPVEEAI
KLAQRISDQSLESRRLCNKPIQSLPNMESIFSEALLKMQKQHPGCLAPETCVRAVQAAVH
CPYEVGIQKEKELFMYLQKSGQARALQYAFFAERNATKWSTPSGASWKTAIAQPISSVGV
VGLGTMGRGIVVSLAKAKIPVIAVESDKKQLETADMIITTLLEKEASKMQRSSHPSLGPK
PRLTTSMKELGGVDLVIEAVFEEINLKKRVFAELSAICKPEAFLCTNTSALDIDEIASST
DRPHLVIGTHFFSPAHVMKLLEIIPSQYSSPTTIATVMNLSKKIKKIGVVVGNCFGFVGN
RMLKPYYNQTYFLLEEGSRPEEIDQVLEEFGFKMGPFRVSDLAGLDVGWKSRQGQGLTGP
MVPSGTPARKRGNRRYCPIPDLLCESGRFGQKTGKGWYQYDKPLGRIHKPDPWLSEFLSQ
YRKTYHIEPRIISQDEILERCLYSLINEAFRILGEGMATDPEHIDVVYLHGYGWPRHRGG
PMFYASTVGLPTVLEKLQKYYRQNPDIPQLEPCDYLKKLASLGNPPLKEWQSLAGPPGSK
L
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgcatggaaatcccaggcgcaatgagtcgctcgattccaagcgctgtcttctttcctgt
tgtaactgtacggctgtactccgtggaataaaagacggattgcagaaagctaccacagac
cgtacagtaaaagctattgtgctttgcggagcagatggcaaattctctgcaggtgctgat
atccacagctttggtgagcccagaaagtctgactttgtactaggacatatagtagatgaa
atacagagaactgagaagcccgtggtggcagctattcaaggcctggctttaggaggggga
ctggagctggcgctgggctgtcactataggattgctcatgcagaggctcaaattggcttc
ccagaagtcacactaggaatccttcctggtgcaagaggaacccagcttctccccagactc
attggagttcctgctgcacttgacttaattacctcaggaagacatgttttggcagatgaa
gcactcaagctgggtatcctagatgaaattgtgaactcagacccggttgaagaagcaatc
aaattagcccagagaatctctgatcaatctctagaatcccgtagactctgcaacaagcca
attcagagcttgcccaacatggagagtattttcagtgaagcccttttgaagatgcagaag
cagcatcccgggtgccttgctccagagacttgtgtccgtgcagtccaggctgccgtgcat
tgtccctacgaagtgggcatccagaaggagaaggagctgtttatgtaccttcagaaatca
gggcaggctagagccctgcaatatgctttctttgcagagaggaatgcaactaagtggtca
actccctctggagcatcctggaaaacagccatagcacagcccatctcctcagttggcgtt
gtcggcttgggaacaatgggccgaggcattgttgtttctcttgcgaaggccaagatccca
gtgattgctgtggaatcggacaagaagcagctagagactgctgatatgataataactacc
ctcttggaaaaggaagcatccaaaatgcagcgtagcagccacccgtcgttaggaccaaaa
cccaggttaactacatctatgaaggagcttggtggtgtagatttagtcattgaagcagta
tttgaggaaattaacctgaagaagagggtctttgctgaactgtcggctatatgcaagcca
gaagcttttctgtgcaccaatacttcagccctagacattgatgagattgcttcttccact
gatcgtcctcacttggtcattggcactcacttcttctcaccagctcacgtcatgaagttg
ttagagattattcccagccaatactcttcccccactaccattgccacagttatgaattta
tcaaaaaagattaaaaaaattggagtagttgtaggtaactgttttggatttgttggcaat
cgaatgttgaagccttattacaatcagacgtatttcttgttagaagaaggcagtaggcca
gaggagatagatcaggtgctggaagagtttggtttcaaaatgggaccttttagagtgtca
gatcttgctggattggatgtgggttggaaatctcgacaagggcaaggtcttactggacct
atggtgccttcaggaactcctgcccggaagcgaggcaacaggagatactgtccaattcct
gatctgctctgtgaatcaggacgatttggccagaagacagggaaaggttggtaccaatat
gataagccattgggtaggattcacaaacctgacccctggctttctgaatttctgtcacag
tacagaaaaacctatcacattgagccacgtatcattagccaggatgagatccttgagcgt
tgcttatattcacttatcaatgaagcattccgtatcttgggagaagggatggctactgat
ccagagcacattgatgttgtctatttacacgggtacggatggccaaggcataggggtgga
cccatgttctatgcctccacagttgggttgcccacagtgctagagaagttgcaaaaatat
tacaggcagaatcctgatattccacaactagagccttgtgactatctgaaaaaattggct
tccctgggcaacccgcctctgaaagaatggcaaagcttggcaggacccccaggcagcaaa
ctgtga

DBGET integrated database retrieval system