KEGG   Canis familiaris (dog): 488148Help
Entry
488148            CDS       T01007                                 

Gene name
MECOM
Definition
(RefSeq) MDS1 and EVI1 complex locus protein EVI1 isoform X1
  KO
K04462  ecotropic virus integration site 1 protein
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04010  MAPK signaling pathway
cfa05200  Pathways in cancer
cfa05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    488148 (MECOM)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    488148 (MECOM)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    488148 (MECOM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cfa03000]
    488148 (MECOM)
Transcription factors [BR:cfa03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    488148 (MECOM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-BED zf-C2H2_8 zf-C2H2_11 PyrI_C
Motif
Other DBs
NCBI-GeneID: 488148
NCBI-ProteinID: XP_005639956
Ensembl: ENSCAFG00000014621
VGNC: 43114
Position
34
AA seq 1240 aa AA seqDB search
MRSKGRARKLATSNECVYGSYPEIPLEEMPDADGVASTPSLNIQEPCSPATSSEAFTPKE
GSPYKAPIYIPDDIPIPAEFELRESNMPGAGLGIWTKRKIEAGEKFGPYVGEQRSNLKDP
SYGWEILDEFCNVKFCIDASQPDVGSWLKYIRFAGCYDQHNLVACQINDQIFYRVVTDIA
PGEELLLFMKSEDYPHETMAPDIHEERQYRCEDCDQLFESKAELADHQKFPCSTPHSAFS
MVEEDFQQKLESENDLRDIHAIQECKECDQVFPDLQSLEKHMLSHTEEREYKCDQCPKAF
NWKSNLIRHQMSHDSGKHYECENCAKQVFTDPSNLQRHIRSQHVGARAHACPECGKTFAT
SSGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSS
LNKHRRFCEGKNHFAAGGFFGQGISLPGTPAMDKTSMVNMSHANPGLADYFGANRHPAGL
TFPTAPGFSFSFPGLFPSGLYHRPPLIPASSPVKGLSSTEQTNKSQSPLMTHPQILPATQ
DILKALSKHPPVGDNKPVELQPERSSEERPLEKISDQSESSDLDDVSTPSGSDLETTSGS
DLESDIESDKEKFKENGKMFKDKVSPLQNLASIHNKKEYSNHSIFSPSLEEQTAVSGVVN
DSIKAIASIAEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRSLP
LKMEPQSPSEVKKLQKGSSESPFDLTTKRKDEKPLTPGPSKPPATPATSQDQPLDLSMGS
RSRASGTKLAEPRKNHVFGEKKGTNIDPRPASDGSLQHARPTPFFMDPIYRVEKRKLTDP
LEALKEKYLRPSPGFLFHPQFQLPDQRTWMSAIENMAEKLESFSALKPEASELLQSVPSM
FNFRAPPNALPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFS
ISSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELES
TGAILDDKEDAYFTEIRNFIGNSNHSSQSPRNTEERMNGSHFKDEKTLVTGQNSDLLDDE
EVEDEVLLDEDDDDNDITGKTGKEPVTSNLHEGNPEDDYEEASALEMSRKTSPVRYKEEE
YKTGLSALDHIRHFTDSLKMRKLEDNQYTEAELSSFSASHVPEELKQPLHRKSKSQAYAM
MLSLSDKESLHSTSHSSSNVWHSMARAAAESSAIQSISHV
NT seq 3723 nt NT seq  +upstreamnt  +downstreamnt
atgagatcaaaaggcagggcaaggaaactggccacaagtaatgagtgtgtatatggcagc
taccctgaaattcctttggaagaaatgccagatgcagatggagtagccagcacgccctcc
ctcaatattcaagagccatgctctccagccacatccagcgaagcattcactccaaaggag
ggctctccatacaaagcccccatctacatccctgatgatatccccattcctgctgagttt
gaacttcgagagtcaaatatgcctggagcaggactaggaatatggaccaaaaggaagatt
gaagcaggtgaaaagtttgggccttatgtgggagagcagaggtcaaacctgaaagacccc
agctatggatgggagatcttagatgagttttgcaatgtgaagttctgcatagatgctagt
caaccagatgtaggaagctggctcaagtacatcaggttcgctggctgttatgatcagcac
aacctcgttgcatgccagataaatgaccagatattttatagagtagtcacagacattgca
ccaggagaggagctcctgctgttcatgaagagtgaagactatccccatgaaactatggcg
ccggatatccacgaagaacggcaatatcgctgcgaggactgtgaccagctctttgagtcc
aaggctgaactagcagatcaccagaaattcccctgcagcacccctcactcagcattttca
atggtggaagaggactttcaacaaaaactcgaaagcgaaaatgatctccgagacatacat
gcaatccaggagtgtaaggaatgtgaccaagttttccctgatttgcaaagcctggagaaa
cacatgttgtcacatacagaagagagggaatacaagtgcgatcagtgtcccaaggcattt
aactggaagtccaatttaattcgccaccagatgtcacatgacagtggaaagcactatgaa
tgtgaaaactgtgccaagcaggttttcacggaccctagcaaccttcagcggcacatccgc
tctcagcatgttggtgcccgggcccacgcgtgcccggagtgtggcaaaacgtttgccact
tcgtcgggcctcaaacaacacaagcacatccacagcagtgtgaagccctttatctgtgag
gtctgccataaatcctatactcagttttcaaacctttgtcgtcataagcgcatgcatgct
gattgcagaacccaaatcaagtgcaaagactgtggacaaatgttcagcactacgtcttcc
ttaaataaacacaggaggttttgtgagggcaagaaccattttgcggcaggtggatttttt
ggccaaggcatttcacttcctggaacccccgctatggataaaacgtccatggttaatatg
agtcatgccaacccgggccttgctgactattttggtgccaataggcatcctgctggtctt
acctttccaacagctcctggattttcttttagcttccctggtctgtttccttccggcttg
taccacaggcctcctttgatacctgctagttctcctgttaaaggactatcaagtactgaa
cagacaaacaaaagtcaaagtcccctcatgacacatcctcagatactgccagctacacag
gatattttgaaggcactatctaaacacccacctgtaggagacaataagccagtggagctc
cagcccgagaggtcctctgaagagaggccccttgagaaaatcagtgaccagtcagagagt
agtgaccttgatgatgtcagtacgccaagtggcagtgacctggaaacaacctcgggctct
gatctggaaagtgacattgaaagtgataaagagaaatttaaagaaaatggtaaaatgttc
aaagacaaagtaagccctcttcagaatctggcttcaatacataataagaaagaatacagc
aatcattccattttctcaccatctttagaggagcaaactgcggtgtcaggagttgtgaat
gattctataaaggctattgcttctattgctgaaaaatactttggttcaacaggactggtg
gggctgcaagacaaaaaagttggagctttaccttacccttccatgtttcccctcccattt
tttccagcattctctcaatcaatgtacccatttcctgatagagacttgagatcgttacct
ttgaaaatggagccccaatcaccaagtgaagtaaagaaactgcagaagggaagctctgag
tctccctttgatctcaccactaagcgaaaggacgagaagcccttgactccaggaccctcc
aagcctccagcaacacctgccacaagccaagaccagcccctcgatctaagcatgggcagt
aggagtagagccagtgggacaaagctggccgagccccgtaaaaaccacgtgtttggggaa
aagaaaggaaccaacattgacccaagaccagcatcggatggttccttgcagcacgctaga
cccactcctttctttatggaccctatttacagagtagagaaaagaaaactaactgaccca
cttgaagctttaaaagagaaatacttgagaccttctccaggattcttatttcacccacaa
ttccaactgcctgatcagagaacttggatgtcagctattgaaaacatggcagagaagcta
gagagcttcagtgccctgaaaccagaggccagtgaacttctgcagtccgttccctccatg
ttcaacttcagagcgcctcccaacgccctgccggagaaccttctgcggaaagggaaagaa
cgctacacctgcagatactgtggcaagatttttccaagatccgcgaacctaacacggcac
ttgagaacccacacaggagagcagccttacagatgcaaatactgtgacagatcgtttagc
atctcttccaacttgcagaggcatgttcgtaacatccacaataaggagaagccctttaag
tgtcacttatgtgataggtgttttggtcaacaaaccaacttagacagacacctaaagaaa
catgagaatgggaacatgtctggtacagcaacatcatcgcctcactccgaactggaaagt
acaggcgcgattctcgatgacaaggaagatgcttacttcacagaaatccgtaatttcatt
gggaatagcaaccacagcagccagtctcccaggaacacagaggagagaatgaatggcagt
cattttaaggatgagaagactttggtgaccggtcagaactcagatttgctggatgatgaa
gaagtagaagatgaagtgttgttagatgaggatgatgatgacaacgatattactggaaaa
acaggaaaagaaccagtgacgagcaatttacatgaaggaaaccctgaggatgactatgag
gaagccagtgccctggagatgagtcgcaaaacgtccccagtgaggtataaagaggaagaa
tataaaactggactttctgctctagatcatataaggcacttcacagatagcctcaaaatg
aggaaactggaagataatcaatatactgaagctgagctgtcttcttttagtgcttcccat
gtgccggaggaacttaaacagccgttacacagaaagtccaaatcacaggcatatgctatg
atgttgtcactgtccgacaaggagtccctccattctacgtcccacagttcttccaacgtg
tggcacagtatggcaagggctgcagcggaatccagtgccatccagtccataagccacgta
tga

DBGET integrated database retrieval system