KEGG   Canis familiaris (dog): 488263
Entry
488263            CDS       T01007                                 

Definition
(RefSeq) histone H3.1
  KO
K11253  histone H3
Organism
cfa  Canis familiaris (dog)
Pathway
cfa05034  Alcoholism
cfa05202  Transcriptional misregulation in cancer
cfa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    488263
  09163 Immune disease
   05322 Systemic lupus erythematosus
    488263
  09165 Substance dependence
   05034 Alcoholism
    488263
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cfa03036]
    488263
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfa04147]
    488263
Chromosome and associated proteins [BR:cfa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    488263
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   488263
SSDB
Motif
Pfam: Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF
Other DBs
NCBI-GeneID: 488263
NCBI-ProteinID: XP_005640158
Ensembl: ENSCAFG00000030845
UniProt: J9PB22
Position
35
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggctcgcacgaagcagacggcgcgcaagtcgacgggcggcaaggccccgcgcaagcag
ctggccaccaaggcggcccgcaagagcgcgccggccaccggcggcgtcaagaagccgcac
cgctaccggcccggcacggtggccctgcgcgagatccggcgctaccagaagtccacggag
ctgctgatccgcaagctgccgttccagcgcctggtgcgcgagatcgcgcaggacttcaag
accgacctgcgcttccagagctcggccgtcatggcgctgcaggaggcgtgcgaggcctac
ctggtggggctcttcgaggacaccaacctctgcgccatccacgccaagcgcgtcaccatc
atgcccaaggacatccagctggcgcgccgcatccgcggggagagggcgtaa

DBGET integrated database retrieval system