KEGG   Canis familiaris (dog): 488277Help
Entry
488277            CDS       T01007                                 

Definition
(RefSeq) histone H4 isoform X1
  KO
K11253  histone H3
Organism
cfa  Canis familiaris (dog)
Pathway
cfa05034  Alcoholism
cfa05202  Transcriptional misregulation in cancer
cfa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    488277
  09163 Immune disease
   05322 Systemic lupus erythematosus
    488277
  09165 Substance dependence
   05034 Alcoholism
    488277
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cfa03036]
    488277
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfa04147]
    488277
Chromosome and associated proteins [BR:cfa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    488277
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   488277
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137
Motif
Other DBs
NCBI-GeneID: 488277
NCBI-ProteinID: XP_013966113
UniProt: F2Z4N2
Position
35
AA seq 103 aa AA seqDB search
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtcgcggcaagggcgggaagggactaggcaagggcggcgccaagcgccaccgc
aaggtgctgcgcgacaacatccagggcatcaccaagcccgccatccggcggctggcccgg
cgcggcggcgtcaagcgcatctcgggcctcatctacgaggagacccgcggggtgctcaag
gtgttcctggagaacgtgatccgggacgccgtcacctacacggagcacgccaagcgcaag
acggtcacggccatggacgtggtctacgcgctcaagcgccagggccgcaccctctacggc
ttcggcggctga

DBGET integrated database retrieval system