KEGG   Canis lupus familiaris (dog): 488305
Entry
488305            CDS       T01007                                 

Definition
(RefSeq) histone H1.5
  KO
K11275  histone H1/5
Organism
cfa  Canis lupus familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cfa03036]
    488305
Chromosome and associated proteins [BR:cfa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    488305
SSDB
Motif
Pfam: Linker_histone
Other DBs
NCBI-GeneID: 488305
NCBI-ProteinID: XP_545427
UniProt: A0A5F4CRD6
Position
35
AA seq 226 aa
MSETAPAETAVPAPVEKSPAKKKATKKAAGSGAAKRKASGPPVSELITKAVAASKERNGL
SLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEAK
PKAKKAGAARAKKPSGATPKKPKKAAGAKKAVKKTPKKAKKPAAAGVKKVAKSPKKVKTS
AKPKKAAKSPAKPKAVKPKAAKPKAAKPKAAKPKPAKAKKAAPKKK
NT seq 681 nt   +upstreamnt  +downstreamnt
atgtcggaaactgctcccgctgagacggctgtcccggcgccggtggagaagtcacctgcc
aaaaagaaggccaccaagaaggcagcgggcagtggcgctgcgaagcgcaaggcgtccggg
cccccggtgtccgagctcatcaccaaggcggtggccgcgtccaaggagcgcaacggcctc
tccttggccgcgctcaagaaggcgctggcggccgccggctacgacgtggagaagaacaac
agccgcatcaagctgggcctcaagagcctggtgagcaaggggaccctggtgcagaccaag
ggcaccggcgcctcgggctccttcaagctcaacaagaaggcggcctccggggaggccaag
cccaaggccaagaaggcgggcgcggccagagccaagaagccctccggggccactccgaag
aaacccaagaaagcggcgggggcgaagaaagcagtgaagaagacccccaagaaggccaag
aagcctgcagccgccggtgtcaaaaaagtagcaaagagccctaagaaagttaaaacgtct
gccaagcctaagaaggcggccaagagtcctgccaagcccaaggcggtgaagcccaaggcc
gccaagccaaaggctgcgaagccaaaggccgcgaagcccaaacctgccaaggccaagaag
gcggccccgaaaaagaagtag

DBGET integrated database retrieval system