KEGG   Canis familiaris (dog): 488473Help
Entry
488473            CDS       T01007                                 

Gene name
CASP8
Definition
(RefSeq) caspase-8
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa01524  Platinum drug resistance
cfa04115  p53 signaling pathway
cfa04210  Apoptosis
cfa04215  Apoptosis - multiple species
cfa04217  Necroptosis
cfa04620  Toll-like receptor signaling pathway
cfa04621  NOD-like receptor signaling pathway
cfa04622  RIG-I-like receptor signaling pathway
cfa04625  C-type lectin receptor signaling pathway
cfa04657  IL-17 signaling pathway
cfa04668  TNF signaling pathway
cfa04932  Non-alcoholic fatty liver disease (NAFLD)
cfa05010  Alzheimer disease
cfa05016  Huntington disease
cfa05134  Legionellosis
cfa05142  Chagas disease (American trypanosomiasis)
cfa05145  Toxoplasmosis
cfa05152  Tuberculosis
cfa05161  Hepatitis B
cfa05163  Human cytomegalovirus infection
cfa05165  Human papillomavirus infection
cfa05167  Kaposi sarcoma-associated herpesvirus infection
cfa05168  Herpes simplex infection
cfa05200  Pathways in cancer
cfa05203  Viral carcinogenesis
cfa05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    488473 (CASP8)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    488473 (CASP8)
   04215 Apoptosis - multiple species
    488473 (CASP8)
   04217 Necroptosis
    488473 (CASP8)
   04115 p53 signaling pathway
    488473 (CASP8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    488473 (CASP8)
   04621 NOD-like receptor signaling pathway
    488473 (CASP8)
   04622 RIG-I-like receptor signaling pathway
    488473 (CASP8)
   04625 C-type lectin receptor signaling pathway
    488473 (CASP8)
   04657 IL-17 signaling pathway
    488473 (CASP8)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    488473 (CASP8)
   05203 Viral carcinogenesis
    488473 (CASP8)
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    488473 (CASP8)
   05016 Huntington disease
    488473 (CASP8)
  09165 Cardiovascular diseases
   05416 Viral myocarditis
    488473 (CASP8)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    488473 (CASP8)
  09167 Infectious diseases
   05134 Legionellosis
    488473 (CASP8)
   05152 Tuberculosis
    488473 (CASP8)
   05161 Hepatitis B
    488473 (CASP8)
   05168 Herpes simplex infection
    488473 (CASP8)
   05163 Human cytomegalovirus infection
    488473 (CASP8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    488473 (CASP8)
   05165 Human papillomavirus infection
    488473 (CASP8)
   05145 Toxoplasmosis
    488473 (CASP8)
   05142 Chagas disease (American trypanosomiasis)
    488473 (CASP8)
  09168 Drug resistance
   01524 Platinum drug resistance
    488473 (CASP8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cfa01002]
    488473 (CASP8)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     488473 (CASP8)
Peptidases [BR:cfa01002]
 Cysteine Peptidases
  Family C14: caspase family
   488473 (CASP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14 DED
Motif
Other DBs
NCBI-GeneID: 488473
NCBI-ProteinID: NP_001041494
Ensembl: ENSCAFG00000025192
VGNC: 38736
UniProt: Q38JA9
Position
37
AA seq 486 aa AA seqDB search
MDFSKCLYNIGEQLDSDELASLKFLSLDYIPQKKQEPIKDPLMLFQRLQEKRMLEESNLF
FLKELLFRINRLDLLMTYLDTSKEDMQQELQIPGRAQISAYRVMLFQISEDVSKLELKSF
KFLLSREISRCKLDDDLNLLDIFIEMEKRVILGERNLDTLKRICDQINKSLLKKITDYEE
LNREQTMNLQRSLDEISNDMSQLPIREGSVKILPMSDSLGEQDYESETSDKVYRMKSKPR
GYCLIFNNYDFSVARREVPKLQSIKDRNGTDLDADALSKTFSELHFEIVHFKDATAKKIC
EVLQSYQSMDHSSKDCFICCILSHGDKGIIYGSDGQEAPIYELTSYFTGSKCPSLAGKPK
IFFIQACQGDKYQKGIAVETDSEQKEAYLEMDSSYQKRYIPEDADFLLGMATVNNCVSYR
NPMEGTWYIQSLCQSLRERCPRGEDILTILTEVNFEVSNKDDRKNMGKQMPQPTFTLRKK
LFFPPN
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggatttcagcaaatgcctctacaatattggggaacagctggacagtgacgaactggcc
tccctcaaattcctgagcttggactacatcccacagaagaagcaggagcccatcaaggat
cccttgatgttattccagagactccaggaaaagagaatgttggaggaaagcaacctgttc
tttttgaaggagctgcttttccgaattaatagactggatctgctgatgacctacctggac
accagcaaggaagacatgcagcaggagcttcagataccaggcagagcccagatctctgcc
tacagggtcatgctttttcagatttcagaagatgtaagcaaattggaattgaaatccttt
aagtttctcttgagccgggagatctccagatgtaaattggatgatgatttgaacttgctt
gatattttcatagagatggagaagagggtcattctaggggaaagaaatttggacaccctg
aaaagaatctgtgaccaaatcaacaaaagcctgctgaagaaaatcacagattacgaagaa
ttaaacagagagcaaacaatgaaccttcaaagaagtctagatgaaatttcaaatgatatg
tctcagttgcctataagggagggatccgtgaagatattgccaatgtcggactctctagga
gaacaggactatgaatcagagacatcggacaaagtttaccgaatgaaaagcaaacctcga
ggatattgtttgatcttcaacaattatgattttagtgtagcacggagggaagtgcccaaa
cttcagagcattaaggataggaatggaacagacttggatgcagatgcgttgagtaagacc
tttagtgagcttcattttgagatagtgcatttcaaagatgctacagcaaagaaaatctgt
gaagttctgcaatcctaccaaagcatggaccacagtagcaaggattgcttcatctgctgc
atcctctcccatggagacaagggcatcatctatggctctgatgggcaggaagcccctatc
tatgagctgacctcttacttcactggttcaaagtgcccttcccttgcaggcaagcccaaa
atcttttttattcaggcttgtcaaggggataaataccagaaaggaatagctgttgagact
gactctgaacagaaggaagcctatttagaaatggactcatcatatcagaagagatatatc
ccagaggatgctgactttctgctggggatggccactgtgaacaactgtgtttcctaccga
aaccccatggaggggacatggtatatacaatcactttgccagagcctaagagaaagatgt
cctaggggtgaagatattctcaccatccttaccgaggtgaactttgaagtgagcaataaa
gatgacaggaaaaacatgggaaaacaaatgccacaaccaactttcacactgagaaaaaaa
ctcttcttccctcctaattga

DBGET integrated database retrieval system