KEGG   Canis familiaris (dog): 488560Help
Entry
488560            CDS       T01007                                 

Gene name
FMOD
Definition
(RefSeq) fibromodulin
  KO
K08121  fibromodulin
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    488560 (FMOD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:cfa00535]
    488560 (FMOD)
Proteoglycans [BR:cfa00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class II
    488560 (FMOD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_9 LRR_6 LRRNT LRR_1 LRR_5
Motif
Other DBs
NCBI-GeneID: 488560
NCBI-ProteinID: XP_545677
Ensembl: ENSCAFG00000009459
VGNC: 40921
UniProt: F1PLN5
Position
38
AA seq 376 aa AA seqDB search
MQWASLLLLAGLCTLSWAQYDEDPLWWFHYLRSQQSSYYDPYDPYPYEPYEPYPYGVEEG
PAYAYGSPPPPEPRDCPQECDCPPNFPTAMYCDNRNLKYLPFVPSRMKYVYFQNNQISSI
QEGVFDNATGLLWIALHGNQITSDKVGRKIFSKLRHLERLYLDHNNLTRMPGPLPRSLKE
LHLDHNQISRVPNNALEGLENLTALYLQHNEIQEVGSAMRGLRSLILLDLSYNHLRKVPD
GLPSALEQLYLEHNNVYSVPDSYFRGSPKLLYVRLSHNSLTNNGLASNTFNSSSLLELDL
SYNQLQKIPPVNTNLENLYLQGNRINEFSISSFCTVVDVMNFSKLQVLRLDGNEIKRSAM
PVDAPLCLRLASLIEI
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgggcctccctcctgctgctggccgggctctgcaccctgtcctgggcccagtat
gatgaagaccccctttggtggttccactacctccgcagccagcagtcctcctattatgat
ccctatgacccttacccctatgagccctatgagccttacccctacggggtggaggaaggc
cctgcctatgcctatggctctccacccccgccagagccccgagattgcccccaggaatgc
gactgtccacccaacttccccacagccatgtactgtgacaaccgcaacctcaagtatctg
cccttcgtcccttcccgcatgaagtacgtctacttccagaacaaccagatctcatctatc
caggaaggtgtcttcgacaatgccacggggctgctctggattgctctccatggcaaccag
atcaccagtgataaggtgggcaggaagatcttctccaagctgaggcacctggagaggctg
tacctagaccacaacaacctgacccggatgcctggcccgctgccgcgatcgctgaaggag
ctccatctcgaccacaaccagatctcgagggtccccaacaatgctctagagggtctggag
aacctcacagcattgtacctccaacacaatgagatccaggaggtgggcagtgcaatgagg
ggcctccggtccctgatcttgctggatctgagttacaaccacctgcggaaggtgcctgat
ggactgccctcggccctggagcagctgtacttggagcacaacaatgtctactcggtccct
gacagctacttccgggggtcgcccaagctgctgtatgtgcggctgtcccacaacagtctc
accaacaatggcctggcctctaacaccttcaactccagcagtctcctggagcttgacctc
tcctataaccagctgcagaagatccccccagtcaacaccaacctggagaatctctacctc
caaggcaataggatcaatgagttctccatcagcagcttctgcaccgtggtggacgtcatg
aacttctccaagctgcaggtgcttcgcctagacggcaacgagattaagcgcagcgcgatg
ccggtggacgcgcccctctgcctgcgccttgccagcctcatcgagatctga

DBGET integrated database retrieval system