KEGG   Canis familiaris (dog): 488649Help
Entry
488649            CDS       T01007                                 

Gene name
DEDD
Definition
(RefSeq) death effector domain-containing protein isoform X1
Organism
cfa  Canis familiaris (dog)
SSDB OrthologParalogGFIT
Motif
Pfam: DED
Motif
Other DBs
NCBI-GeneID: 488649
NCBI-ProteinID: XP_022271143
Ensembl: ENSCAFG00000012746
VGNC: 39872
Position
38
AA seq 320 aa AA seqDB search
MAGLKRRASQVWPEEHGEQEHGLYSLHRMFDIVGTHLTHRDVRVLSFLFVDVIDDHERGL
IRNGRDFLLALERQGRCDESNFRQVLQLLRIITRHDLLPYVTLKRRRAGEVCPDLVDKYL
EETSIRYVTPRALSDPEPRPPQPPKTVPPHYPVVCCPTSGPQMCSKRPARGRATLGSQRK
RRKSVTPDPKEKQTCDIRLRVRAEYCQHETALQGNVFSNKQDPLERQFERFNQANTILKS
RDLGSIICDIKFSELTYLDAFWRDYINGSLLEALKGVFITDSLKQAVGHEAIKLLVNVDE
EDYELGRQKLLRNLMLQALP
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcctaaagcggcgggcaagccaggtgtggccagaagagcatggtgagcaggag
cacgggctgtacagcctgcaccgcatgtttgacatcgtgggcacccacctgacacacagg
gatgtgcgcgttctttctttcctctttgtcgacgtcattgatgaccatgagcgtggcctc
atccgaaatggacgtgacttcttattggcgttggagcgccagggccgctgtgatgagagt
aactttcgccaggtgctgcagctgctgcgcatcatcactcgtcatgacctgctgccctac
gtcaccctcaagaggaggcgggctggtgaggtgtgccctgatcttgtagacaagtatctg
gaggagacgtcaattcgctatgtgacccccagagccctcagcgatccagaaccgaggcct
ccacaaccccccaaaacagtgcctccccactatcctgtggtgtgctgccccacttcgggc
cctcagatgtgtagcaagcggccagctcgagggagagccacacttgggagccaacgaaaa
cgccggaagtcagtaacaccagaccccaaggaaaagcagacatgtgacatcagactgcgg
gttcgggctgagtactgccagcatgagaccgctctgcaaggcaacgtcttctctaacaag
caggacccactcgagcgccagtttgagcgctttaaccaggccaacaccatcctcaagtct
cgggacctgggctccatcatctgtgacatcaagttctctgagctcacctacctcgacgca
ttctggcgcgactacatcaacggctctctactagaggcgcttaaaggcgtctttatcaca
gactccctcaagcaggctgtgggccacgaagccatcaagctgctggtgaacgtggacgag
gaggactacgagctgggccggcagaaactcctgaggaacttgatgctgcaggcactgccc
tga

DBGET integrated database retrieval system