KEGG   Canis familiaris (dog): 488820Help
Entry
488820            CDS       T01007                                 

Gene name
BST1
Definition
(RefSeq) ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2
  KO
K18152  ADP-ribosyl cyclase 2 [EC:3.2.2.6 2.4.99.20]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00760  Nicotinate and nicotinamide metabolism
cfa01100  Metabolic pathways
cfa04970  Salivary secretion
cfa04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    488820 (BST1)
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    488820 (BST1)
   04972 Pancreatic secretion
    488820 (BST1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:cfa04090]
    488820 (BST1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cfa00537]
    488820 (BST1)
Enzymes [BR:cfa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.20  2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase
     488820 (BST1)
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.6  ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase
     488820 (BST1)
CD molecules [BR:cfa04090]
 Proteins
  488820 (BST1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cfa00537]
 Enzymes
  488820 (BST1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rib_hydrolayse
Motif
Other DBs
NCBI-GeneID: 488820
NCBI-ProteinID: XP_545938
Ensembl: ENSCAFG00000015312
VGNC: 38541
Position
3
AA seq 312 aa AA seqDB search
MAALGLASSLPLLLLVIAGAGGAGGARWRGEGTTRHLQSIILGRCAEHVALLNPEQGEKN
CTAIWEAFKVVLDKDPCSVFPSDYDLFINLSRHSIPTDKSLFWENNHLLVTSYAENARRF
VPLCSVLYGRMGDFLSWCRQENASELDYQSCPTSEDCENNPVDSFWKRASMQYSRDSSGV
IYVMLNGSEPTGAYPVKGFFADFEIPYFQKDKITRIEIWVMHEIGRPKVESCGEGSVKIL
EERLKQMGFQYSCINDHLPVKLLKCVDHSTHPDCALKSAAASIQREVPPLWSEYGGSLIT
PFLVALASAIQM
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggcagccctggggctcgcgtcttcgctaccgctgctgctgctggtgatcgcgggcgct
gggggcgctgggggcgcccgatggcgcggggagggcaccacccggcacctgcagagcatc
atcctgggccgctgcgcggagcacgtcgccctgctgaacccggagcagggggaaaagaac
tgcacggctatctgggaagcctttaaagtggtgttggataaggatccctgttccgtattc
ccctcagactatgacctttttattaacctctccagacattccattcccacagacaagtcc
ctgttctgggaaaacaaccaccttcttgtcactagttatgcagagaatgcccgtcgcttt
gtgcctctgtgcagtgttctctatggcaggatgggtgactttctgagctggtgtcgacag
gaaaatgcctctgaactcgattaccagtcctgccctacatcagaagattgtgaaaacaac
cctgtggattctttctggaaaagggcatctatgcagtattcaagggatagttctggggtc
atctatgtcatgctgaatggttcagagccaacaggagcctatcctgttaaaggctttttt
gcagattttgaaattccctacttccaaaaggataaaatcacacgaattgagatctgggtt
atgcatgaaatcggaagaccaaaagtggaatcctgtggagaaggcagtgtgaaaatcctg
gaagagagactgaagcaaatgggttttcagtacagctgtattaatgatcacctaccggtg
aagctcttgaagtgtgtagaccacagcactcatcctgactgtgccttgaaatcagcagca
gcatctattcaaagagaagtcccacctctctggtcagaatatggtggcagccttatcact
cctttcttagtggctctggcttcagctattcaaatgtaa

DBGET integrated database retrieval system