KEGG   Canis familiaris (dog): 488857Help
Entry
488857            CDS       T01007                                 

Definition
(RefSeq) cytosolic beta-glucosidase
  KO
K05350  beta-glucosidase [EC:3.2.1.21]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00500  Starch and sucrose metabolism
cfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    488857
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     488857
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-GeneID: 488857
NCBI-ProteinID: XP_013968137
Ensembl: ENSCAFG00000016529
VGNC: 53175
Position
3
AA seq 433 aa AA seqDB search
MTVYWAPLNKGHTSPHLAECSGWPPSDSMAFPAGFGWGASTAAYQVEGGWDADGKGPSVW
DTFTHQGGERVFKNQTGDVACGSYTLWEEDLKCIKQLGLTHYRFSLSWSRLLPDGTTGFI
NQKGIDYYNKIIDDLLANGVMPIVTLYHFDLPQALENKGGWLSEAIVESFDKYARFCFST
FGDRVKQWITINEPNIFALLAYDLGIFPPGIPHIGTGGYQAAHNLIKAHARSWHSYNSLF
RREQKGMVSLAIFAPWVEPADPNSVSDQEAAKRAIAFSLDFFAKPIFTDGDYPEVVKSQI
AFMSKKQGYPSSRLPEFTEEEKRMIKGTADFFALNYYTTCLVKYQENKKGELGFLQDVEI
EIFPDPSWISLGWIYMVPWGIRKLLKYIKDTYNNPVIYITENGFSQGDPASLDDTQRWEY
FRQTFQELFKGSC
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgactgtttactgggctcctctgaataaaggacacacaagtccccatttggcagagtgt
tccggctggccaccttctgacagcatggctttcccggcaggatttggatggggggcatcc
actgcagcttatcaagtggaaggaggctgggatgcagatggaaaaggccctagtgtctgg
gacacattcacccatcagggaggagagagagttttcaagaaccagactggcgatgtagct
tgtggcagctacactctgtgggaggaagatttgaaatgtatcaaacagcttggattgact
cattaccgcttctctctttcctggtcacgtctgttacctgatgggacgacaggtttcatc
aaccagaaaggaattgactattacaacaagatcattgatgatttgttagctaatggagtc
atgcccatagtgaccctctaccactttgacttgcctcaggccttagaaaacaaaggaggt
tggttgtcagaggcaatcgttgaatcctttgacaaatatgcccggttttgcttcagtact
tttggagatcgagtcaagcagtggattaccataaatgagcctaatatttttgccctgctg
gcatatgatcttggtatatttcctcctggcatacctcacatcggaaccggaggttatcag
gcagctcataatttgattaaagctcacgccagatcctggcacagctataattccttattc
cgaagagagcagaagggcatggtgtccctagcaatttttgctccctgggtggaaccagca
gatcccaactcagtgtctgaccaggaagctgctaaaagagccatagctttctccttggat
ttctttgctaaacccatatttactgatggtgattatccggaagttgtcaagtcccagatt
gccttcatgagtaaaaagcaaggctatccatcatcaaggcttccagaatttacagaagaa
gagaagagaatgattaaaggcactgctgatttctttgctctgaattattatacaacttgc
ttagtcaagtaccaggagaataagaaaggagaactgggttttctccaggatgtggagatt
gaaatttttccagatccatcttggataagtttgggttggatctacatggtaccatgggga
atacgtaaactactgaaatacattaaggacacatataataaccctgtaatttacatcact
gagaatgggttttcccagggtgaccctgcatctcttgatgacactcagcgctgggagtat
ttcagacagacatttcaggaactgttcaaaggatcctgctag

DBGET integrated database retrieval system